Protein Info for LU632_RS03175 in Erwinia tracheiphila SCR3

Name: sctV
Annotation: type III secretion system export apparatus subunit SctV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 717 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 45 to 64 (20 residues), see Phobius details amino acids 76 to 95 (20 residues), see Phobius details amino acids 111 to 134 (24 residues), see Phobius details amino acids 203 to 223 (21 residues), see Phobius details amino acids 235 to 260 (26 residues), see Phobius details amino acids 296 to 328 (33 residues), see Phobius details TIGR01399: type III secretion protein, HrcV family" amino acids 18 to 697 (680 residues), 845.5 bits, see alignment E=1.7e-258 PF00771: FHIPEP" amino acids 30 to 689 (660 residues), 693.6 bits, see alignment E=1.5e-212

Best Hits

Swiss-Prot: 89% identical to HRPI_ERWAM: Harpin secretion protein HrpI (hrpI) from Erwinia amylovora

KEGG orthology group: K03230, type III secretion protein SctV (inferred from 89% identity to eay:EAM_2896)

Predicted SEED Role

"Type III secretion inner membrane channel protein (LcrD,HrcV,EscV,SsaV)" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (717 amino acids)

>LU632_RS03175 type III secretion system export apparatus subunit SctV (Erwinia tracheiphila SCR3)
MSSLFVWLNRLAISAMQRSEVVGATIVMSIVFMMIIPLPTSLIDVLIALNICISSLLIVL
AMYLPKPLAFSTFPSVLLLTTMFRLALSISTTRQILLQQDAGHIVEAFGNFVVGGNLAVG
LVIFLILTVVNFLVITKGSERVAEVAARFTLDAMPGKQMSIDSDLRAGLIEAHQARQRRE
NLAKESQLFGAMDGAMKFVKGDAIAGLVIVFINMIGGFAIGVLQNGMDTSAAMHIYSVLT
IGDGLIAQIPALLISLTAGMIITRVSADGQQVDANIGREIAEQLTSQPKAWIMSAAGMLG
FALLPGMPTAVFLIISAVALGSGLFQLWRTKQETTQQEANQRQAQQLPPEENGYQDLRRF
NPTRAYLLQFSLNHAGSESASALIQNIRRLRNRLVYNFGFTLPSFDIEFSPMLADDEFRF
CVYEIPLVTATFAVEEKAVRKNNVETWLAEHADEPTHPMMPGLAERDETHWYWLQPQHPL
LQQDDQRSLKAEQLIMLRMEQAIHQSGSQFIGLQESKSILNWLESEQPELAQELQRIMPL
SRFAAVLQRLASERIPLRSVRTIAETLIEHGQHERESTALADFVRIALKEHICHQYLQPN
GLDVWLLTPETEELLRDSLRQTQSETFFSLAHEYGISMLHQMRQAFPAYNNTQALILVAQ
DLRSPLRGLLKDEFHAVPVLSFAELTSNIAINVLGRFDLQQSPPDLQEDDSCMNYAY