Protein Info for LU632_RS02960 in Erwinia tracheiphila SCR3

Annotation: D-alanine--D-alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01205: D-alanine--D-alanine ligase
  • amino acids 4 to 305 (302 residues), 359.5 bits, E=6.8e-112
• PF01820: Dala_Dala_lig_N
  • amino acids 55 to 86 (32 residues), 40.1 bits, 1.3e-13
• PF02786: CPSase_L_D2
  • amino acids 102 to 275 (174 residues), 37.4 bits, E=5e-13
• PF07478: Dala_Dala_lig_C
  • amino acids 103 to 303 (201 residues), 230.7 bits, E=3.2e-72
• PF02655: ATP-grasp_3
  • amino acids 136 to 273 (138 residues), 24.9 bits, E=4.8e-09
• PF13535: ATP-grasp_4
  • amino acids 138 to 273 (136 residues), 32.8 bits, E=1.3e-11

Best Hits

Swiss-Prot: 79% identical to DDL_ERWT9: D-alanine--D-alanine ligase (ddl) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K01921, D-alanine-D-alanine ligase [EC: 6.3.2.4] (inferred from 85% identity to ebi:EbC_07220)

MetaCyc: 70% identical to D-alanine--D-alanine ligase B (Escherichia coli K-12 substr. MG1655)
D-alanine--D-alanine ligase. [EC: 6.3.2.4]

Predicted SEED Role

"D-alanine--D-alanine ligase B (EC 6.3.2.4)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.4)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (12/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• D-Alanine metabolism
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.4

Protein Sequence (306 amino acids)

>LU632_RS02960 D-alanine--D-alanine ligase (Erwinia tracheiphila SCR3)
MADKVAVLLGGTSAEREVSLMSGNAVAAGLKEAGVDAHPLDIRDYPVLRLKDDGFNKVFI
ALHGRGGEDGTLQGVLEFLAIPYTGSGVMASAITMDKLRTKCLWQGADLPVAPYVAMTRQ
ENDAGLSEEAKAAIAALGMPLFVKPSSEGSSVGISRVNQMDALQAALDEAFRHDDEVLIE
AFLSGPEYTVGVIGDSILPSIKIQVVSEFYDYEAKYFSDDTQYFCPSGLSREKEAELSEI
VMKAWRALGCSGWGRVDVMMDGDGEFYLLEVNTSPGMTSHSLVPMAAKQAGMSFSQLVAR
ILELAD