Protein Info for LU632_RS02915 in Erwinia tracheiphila SCR3

Name: ftsL
Annotation: cell division protein FtsL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 106 transmembrane" amino acids 23 to 42 (20 residues), see Phobius details PF04999: FtsL" amino acids 10 to 104 (95 residues), 124.5 bits, see alignment E=6.8e-41 TIGR02209: cell division protein FtsL" amino acids 21 to 103 (83 residues), 93.5 bits, see alignment E=2.9e-31

Best Hits

Swiss-Prot: 80% identical to FTSL_YERPE: Cell division protein FtsL (ftsL) from Yersinia pestis

KEGG orthology group: K03586, cell division protein FtsL (inferred from 93% identity to ebi:EbC_07130)

Predicted SEED Role

"Cell division protein FtsL" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (106 amino acids)

>LU632_RS02915 cell division protein FtsL (Erwinia tracheiphila SCR3)
MIGNERHSLPGVIASDILRHGKIPVILITAVLVSAVLVVTTAHKTRLLTAQREQLLLERD
ALDIEWRNLILEENALGDHSRVERMATEKLQMQHVDPSQENIVVQP