Protein Info for LU632_RS02490 in Erwinia tracheiphila SCR3

Annotation: DUF1328 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 53 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 48 (20 residues), see Phobius details PF07043: DUF1328" amino acids 6 to 44 (39 residues), 44 bits, see alignment E=1.1e-15

Best Hits

Swiss-Prot: 89% identical to Y663_ERWT9: UPF0391 membrane protein ETA_06630 (ETA_06630) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: None (inferred from 90% identity to eae:EAE_10565)

Predicted SEED Role

"FIG01200701: possible membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (53 amino acids)

>LU632_RS02490 DUF1328 domain-containing protein (Erwinia tracheiphila SCR3)
MFRWGIIFLVIALIAAALGFDGLVGKAAWAAKIVFVVGIIIFLVSLFTGRKKL