Protein Info for LU632_RS02410 in Erwinia tracheiphila SCR3

Annotation: FAD-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01494: FAD_binding_3
  • amino acids 12 to 337 (326 residues), 184.8 bits, E=2.8e-58
• PF13450: NAD_binding_8
  • amino acids 14 to 43 (30 residues), 27.3 bits, see alignment (E = 3.7e-10)

Best Hits

KEGG orthology group: None (inferred from 67% identity to rah:Rahaq_2122)

Predicted SEED Role

"Salicylate hydroxylase (EC 1.14.13.1)" in subsystem Salicylate and gentisate catabolism or Salicylate ester degradation (EC 1.14.13.1)

MetaCyc Pathways

• methylsalicylate degradation (2/2 steps found)
• salicylate degradation I (1/1 steps found)
• chlorosalicylate degradation (2/7 steps found)
• superpathway of salicylate degradation (1/7 steps found)
• naphthalene degradation to acetyl-CoA (2/12 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (6/42 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Bile acid biosynthesis
• Fluorene degradation
• Naphthalene and anthracene degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.1

Protein Sequence (402 amino acids)

>LU632_RS02410 FAD-dependent oxidoreductase (Erwinia tracheiphila SCR3)
MNKKVVPSAMSCCIVGGGPAGLMLGYLFARRGITVTVLEKHGDFLRDFRGNTIHPSTMEI
ISQLGFLDELLAIPHQKAERLYSETKGKETILADFSHLPTRCKYIAFMPQWDFLHLLYSK
ASLLPGFSLIKKATVNGLIEEQGAVRGVRAQLDGKVHEFRCDLVIGCDGRDSTVRDLAGL
DVRRFGAPRDVLWLKISKLPGDPVLTMGHRGAEKNFIMVDRGSYWQCGYSISKGSFPALK
ENGLADFLQQVTHESPFDISRLQQEITDWQHVSLLKIRIDRLDKWAKNGLLCIGDAAHAM
SPIGGVGVNLAIQDAVATANLLSAPLKTGRLTLKDLQKVQRRRIFPTWATQSLQIMISKA
GQNKRRKSPGKMELWLRQRKCLARLSGRLIGIGFFLELPNGG