Protein Info for LU632_RS02315 in Erwinia tracheiphila SCR3

Annotation: TerC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 41 to 63 (23 residues), see Phobius details amino acids 83 to 105 (23 residues), see Phobius details amino acids 114 to 136 (23 residues), see Phobius details amino acids 142 to 160 (19 residues), see Phobius details amino acids 200 to 222 (23 residues), see Phobius details amino acids 228 to 229 (2 residues), see Phobius details amino acids 236 to 256 (21 residues), see Phobius details amino acids 268 to 286 (19 residues), see Phobius details amino acids 292 to 312 (21 residues), see Phobius details TIGR03718: integral membrane protein, TerC family" amino acids 7 to 313 (307 residues), 392.5 bits, see alignment E=7.2e-122 PF03741: TerC" amino acids 80 to 283 (204 residues), 178.4 bits, see alignment E=6.1e-57

Best Hits

Swiss-Prot: 76% identical to ALX_SALTY: Putative membrane-bound redox modulator Alx (alx) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 85% identity to pva:Pvag_2722)

Predicted SEED Role

"Integral membrane protein TerC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (323 amino acids)

>LU632_RS02315 TerC family protein (Erwinia tracheiphila SCR3)
MNTVGTPLLWSSFAVVLLIMLAIDLLLQAGRGSQTMALKQAALWSLVWISMALFFAAGLW
WYLQGSAGPEIAHKQALAFLTGYVLEKALAVDNVFVWLMLFSYFTVPANLQRRVLIYGVL
GAIVLRTIMIFAGSWLVNEFSWILYVFGAFLLFTGVKMSMAGKEGDGAVGDKPVVRWLRG
HLRMTDNLEGEKFFVRRNGVLFATPLLLVLIMVELSDVIFAVDSIPAIFAVTTDPFIVLT
SNLFAILGLRAMYFLLAGVAERFSMLKYGLAVILVFIGFKMLIVDFYHIPVAVSLSVVGG
ILAVTLIINALVNRHNDQHLKNK