Protein Info for LU632_RS02205 in Erwinia tracheiphila SCR3

Annotation: BglG family transcription antiterminator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 636 PF08279: HTH_11" amino acids 7 to 63 (57 residues), 38.6 bits, see alignment 1.9e-13 PF08220: HTH_DeoR" amino acids 7 to 45 (39 residues), 22.3 bits, see alignment 2.2e-08 PF05043: Mga" amino acids 92 to 165 (74 residues), 35.6 bits, see alignment E=2.8e-12 PF00874: PRD" amino acids 299 to 386 (88 residues), 71.1 bits, see alignment E=2e-23 PF00359: PTS_EIIA_2" amino acids 507 to 623 (117 residues), 61.2 bits, see alignment E=2.8e-20

Best Hits

KEGG orthology group: None (inferred from 92% identity to ebi:EbC_04940)

Predicted SEED Role

"Putative BglB-family transcriptional antiterminator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (636 amino acids)

>LU632_RS02205 BglG family transcription antiterminator (Erwinia tracheiphila SCR3)
MRFPNQRLAQLFDMLQNETLPQDELARRFDVSTRTVRTDITTLNELLADHGVRFVLNRGE
GYQIKIEDAVRYSQLQQQSPSHLRVPRTSAARVHYLLTRFLTSAFSLKLEDLAAEWFVSR
ATLQSDMAEVREWLARYQLAIETRPRYGMKLFGSEVSIRTCLTDLLYQIAQEDSEDPLLN
LEALNSGMLGTLQPLLHQCFSRFNIRMNDDSEFYLRLYCAVAVRRISEGYPLSDFSAEDV
DDDVRDAARHIINLMQPITGKAISPSEEAYLRVNIAARRVEDIAPSVISPDDGESLVNYI
LSYINTHYNFNLLNDSQLRADLLTHIKTMITRVRYQINIPNPLLANIKHHYPMAYDVTLA
AVSSWGKYTPYVISENEIGFLVLHIGVGLERHYNVGYQRHPQILLVCDTGNSTVRMIQAM
LMRKYPQIIVNNIVSLREYEQQESIEADFVISTARLTEKDKPVVVMSPFPTEFQLEQIGK
LVLVDRTRPYMLEKFFDVSHFCIIDQPMTQTSLFRTLCDQLEHEGVVDRDFYPSVEEREA
IVSTMLGEGIALPHSLGLLAKKTVVYTVLAPQGIAWGDETAYVIFLLAISKTEYEEAMAI
YDLFVTFMRERAMTRLRDSKNFISFKAVAMDCLSRL