Protein Info for LU632_RS02190 in Erwinia tracheiphila SCR3

Annotation: DgaE family pyridoxal phosphate-dependent ammonia lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 TIGR01437: uncharacterized pyridoxal phosphate-dependent enzyme" amino acids 4 to 366 (363 residues), 581.5 bits, see alignment E=3e-179 PF03841: SelA" amino acids 56 to 268 (213 residues), 48.2 bits, see alignment E=8.6e-17

Best Hits

KEGG orthology group: K01042, L-seryl-tRNA(Ser) seleniumtransferase [EC: 2.9.1.1] (inferred from 91% identity to ebi:EbC_04910)

Predicted SEED Role

"D-Glucosaminate-6-phosphate ammonia-lyase (EC 4.3.1.-)" (EC 4.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.9.1.1 or 4.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (373 amino acids)

>LU632_RS02190 DgaE family pyridoxal phosphate-dependent ammonia lyase (Erwinia tracheiphila SCR3)
MSSIYEKYGLKQVINASGRMTILGVSTPAADVVDTVKYGLNHYFEIKDLVNKTGAYIASL
LGCEDAVVVACASAGIAQSVAAVIVKDDDWLLENLHAAPLVVPHDIVVPKGHNVNFGAPV
GTMVAMGGGRLIEAGYANECSADQLSAAVTPQTAAILYIKSHHCVQKSHLSVEQAAVVAR
KHGVPLIVDAAAEEDLQCYYQDGADLVIYSGAKAIEGPTSGLVMGRKQYVEWVKRQSMGI
GRAMKVGKEGILGLTQAIENYLVQEKVSGAQMVEKMTPFIDNLNALNGISARVVWDAAGR
DIARAEIHFDEAVIGHTTGDVVQVLKTGEIAIYFRGYKANEGIVEVDVRSLTADQLNTIF
VCIKALLSGGKNA