Protein Info for LU632_RS02065 in Erwinia tracheiphila SCR3

Name: hflK
Annotation: FtsH protease activity modulator HflK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 transmembrane" amino acids 71 to 91 (21 residues), see Phobius details PF12221: HflK_N" amino acids 1 to 57 (57 residues), 58.6 bits, see alignment 4.5e-20 TIGR01933: HflK protein" amino acids 88 to 346 (259 residues), 400.8 bits, see alignment E=1.3e-124 PF01145: Band_7" amino acids 90 to 263 (174 residues), 106.4 bits, see alignment E=1.7e-34

Best Hits

Swiss-Prot: 75% identical to HFLK_ECO57: Protein HflK (hflK) from Escherichia coli O157:H7

KEGG orthology group: K04088, membrane protease subunit HflK [EC: 3.4.-.-] (inferred from 86% identity to ebi:EbC_04540)

MetaCyc: 75% identical to regulator of FtsH protease (Escherichia coli K-12 substr. MG1655)
3.4.24.-

Predicted SEED Role

"HflK protein" in subsystem Hfl operon

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (413 amino acids)

>LU632_RS02065 FtsH protease activity modulator HflK (Erwinia tracheiphila SCR3)
MAWNQPGNNGQDRDPWGSSNNQGGNSGGNKGARDNGPPDLDDIFRKLSKKLGGFGGGKSD
GQKTPGFGSRATGIVVAAAVVIWAGSGFYTIKEAERGVVTRFGKFSHLVEPGLNWKPTFV
DEVRAVNVESVRELAASGTMLTSDENVVRVEMNVQYRVTNPERYLFAVTSADDSLRQATD
SALRGVIGRSTMDRILTEGRTVVRSDTQRELEETIRPYDMGITLLDVNFQAARPPEEVKA
SFDDAIAARENREQYVREAEAYANEVQPRANGQAQRILEEARAYKTRTVLEAQGEVDRFA
RILPEYKSAPQITRERLYIETMERVLSHTRKVLVNDKGNSLMVLPMDQLMRGQTEAKATS
SQESTSNNLFRMAPATSPGDAAGNSNSLNNSASFMDQRRENALRNNTQRAGGE