Protein Info for LU632_RS00965 in Erwinia tracheiphila SCR3

Name: thiE
Annotation: thiamine phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00693: thiamine-phosphate diphosphorylase
  • amino acids 20 to 202 (183 residues), 170.8 bits, E=1.1e-54
• PF02581: TMP-TENI
  • amino acids 21 to 189 (169 residues), 166 bits, E=3e-53

Best Hits

Swiss-Prot: 72% identical to THIE_ECOK1: Thiamine-phosphate synthase (thiE) from Escherichia coli O1:K1 / APEC

KEGG orthology group: K00788, thiamine-phosphate pyrophosphorylase [EC: 2.5.1.3] (inferred from 74% identity to ebi:EbC_02660)

MetaCyc: 71% identical to thiamine phosphate synthase (Escherichia coli K-12 substr. MG1655)
Thiamine-phosphate diphosphorylase. [EC: 2.5.1.3]; 2.5.1.3 [EC: 2.5.1.3]; 2.5.1.3 [EC: 2.5.1.3]

Predicted SEED Role

"Thiamin-phosphate pyrophosphorylase (EC 2.5.1.3)" in subsystem Thiamin biosynthesis (EC 2.5.1.3)

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis I (10/10 steps found)
• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• thiamine diphosphate biosynthesis I (E. coli) (2/2 steps found)
• thiamine diphosphate biosynthesis II (Bacillus) (2/2 steps found)
• thiamine diphosphate salvage II (4/5 steps found)
• thiamine diphosphate salvage V (2/3 steps found)
• thiamine diphosphate biosynthesis III (Staphylococcus) (1/3 steps found)
• thiamine diphosphate biosynthesis IV (eukaryotes) (1/3 steps found)
• superpathway of thiamine diphosphate biosynthesis III (eukaryotes) (3/7 steps found)
• thiamine diphosphate salvage IV (yeast) (3/7 steps found)
• thiamine diphosphate formation from pyrithiamine and oxythiamine (yeast) (3/8 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.3

Protein Sequence (215 amino acids)

>LU632_RS00965 thiamine phosphate synthase (Erwinia tracheiphila SCR3)
MKPSPFPATARRLGLYPVVDSVTWISRLLDAGARTIQLRLKNLTEDAAGQQVADAVALGY
RYQARLFINDYWRLAIKHQAYGVHLGQQDLDSADLSAIQRAGLRLGLSTHDDVELDRALA
IRPSYIALGHIFPTQTKQMPSAPQGVEELKRHVSRLPGISTVAIGGISLARAPVVLATGV
GSIAVVSAITQVSNWQSATQQLLALAGQGGDPHVQ