Protein Info for LU632_RS00960 in Erwinia tracheiphila SCR3

Annotation: HesA/MoeB/ThiF family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00899: ThiF
  • amino acids 10 to 243 (234 residues), 230.2 bits, E=1.7e-72

Best Hits

Swiss-Prot: 62% identical to THIF_ECOLI: Sulfur carrier protein ThiS adenylyltransferase (thiF) from Escherichia coli (strain K12)

KEGG orthology group: K03148, adenylyltransferase [EC: 2.7.7.-] (inferred from 73% identity to ebi:EbC_02650)

MetaCyc: 62% identical to sulfur carrier protein ThiS adenylyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-9789 [EC: 2.7.7.73]

Predicted SEED Role

"Sulfur carrier protein adenylyltransferase ThiF" in subsystem Thiamin biosynthesis

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis I (10/10 steps found)
• thiazole component of thiamine diphosphate biosynthesis I (6/6 steps found)
• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (5/7 steps found)

KEGG Metabolic Maps

• Biosynthesis of siderophore group nonribosomal peptides
• Lipopolysaccharide biosynthesis
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.-

Use Curated BLAST to search for 2.7.7.- or 2.7.7.73

Protein Sequence (253 amino acids)

>LU632_RS00960 HesA/MoeB/ThiF family protein (Erwinia tracheiphila SCR3)
MFSDSDFMRYSRQLLLEEFGVDTQQKLFNSRVLIVGLGGLGSPAALYLAAAGVGTLLLAD
DDTVHISNLQRQILFHTHQSGQRKTEIARQHLLSLNPTLEVVTLDQRMNTDTLKQAIKLV
DMVLDCSDNMPTRHAINAACLHHAIPLISASATGFSGQLLVLTPPFQHGCYRCLWPDEAE
PTRNCRTAGVLGPVVGIMGTMQALEALKMLAGLASPLTGKLQLFDGRQQTWRTLNLERSA
LCPLCGGGLEHHH