Protein Info for LU632_RS00900 in Erwinia tracheiphila SCR3

Name: secE
Annotation: preprotein translocase subunit SecE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 127 transmembrane" amino acids 16 to 36 (21 residues), see Phobius details amino acids 43 to 63 (21 residues), see Phobius details amino acids 94 to 119 (26 residues), see Phobius details PF00584: SecE" amino acids 70 to 122 (53 residues), 68.7 bits, see alignment E=1.7e-23 TIGR00964: preprotein translocase, SecE subunit" amino acids 70 to 123 (54 residues), 57.8 bits, see alignment E=3.8e-20

Best Hits

Swiss-Prot: 89% identical to SECE_SALTY: Protein translocase subunit SecE (secE) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03073, preprotein translocase subunit SecE (inferred from 91% identity to esc:Entcl_4183)

MetaCyc: 88% identical to Sec translocon subunit SecE (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Preprotein translocase subunit SecE (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (127 amino acids)

>LU632_RS00900 preprotein translocase subunit SecE (Erwinia tracheiphila SCR3)
MSANTEAQGSGRGLEVIKWLVVAVLLIAAIVGNYFYRDITLPLRALAVVILIAAAGCIAL
LTAKGKSTLAFASEARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS
FITGLRF