Protein Info for LU632_RS00815 in Erwinia tracheiphila SCR3

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 76 to 97 (22 residues), see Phobius details amino acids 107 to 126 (20 residues), see Phobius details amino acids 172 to 192 (21 residues), see Phobius details amino acids 208 to 227 (20 residues), see Phobius details amino acids 269 to 289 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 88 to 286 (199 residues), 69.1 bits, see alignment E=2.2e-23

Best Hits

Swiss-Prot: 45% identical to MALF_THELN: Trehalose/maltose transport system permease protein MalF (malF) from Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C)

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 87% identity to ebi:EbC_43320)

MetaCyc: 36% identical to ABC-type 3-(6-sulfo-alpha-D-quinovosyl)-sn-glycerol transporter permease subunit (Agrobacterium fabrum)
7.5.2.M1 [EC: 7.5.2.M1]

Predicted SEED Role

"Glucosamine ABC transport system, permease protein 2"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.M1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (302 amino acids)

>LU632_RS00815 sugar ABC transporter permease (Erwinia tracheiphila SCR3)
MLSLQQRERRQAWVLLAPMLLMMGLLTTWPLLRTIRLSFTDAALISNGGTINYIGVENYL
YALTDPDFLSSLLRTLYFTVTSVALEGIIGVLVALLLNQKFYGRSVLRVLVILPWALPTI
VNAMMWRLNFNPDYGSINALLTQLGIIGNYRSWLGSPDSALNAVMVADVWKNYPLVTLLV
LAALQSIPDHLFEAAMLDGASALHRFRAIIFPAIVGPLSVALVLRTIDAFKVFDVIYVMT
RGGPVDSTKTLSFYVYQESFSYLRAGSGAAYAILMTLMCSVLIAVYMTMVWRQRRRSSAY
ET