Protein Info for LU632_RS00695 in Erwinia tracheiphila SCR3

Annotation: fimbria/pilus periplasmic chaperone

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00345: PapD_N" amino acids 23 to 144 (122 residues), 143 bits, see alignment E=4.8e-46 PF02753: PapD_C" amino acids 168 to 230 (63 residues), 55.1 bits, see alignment E=7.4e-19

Best Hits

KEGG orthology group: None (inferred from 57% identity to cro:ROD_27791)

Predicted SEED Role

"Chaperone protein fimC precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (248 amino acids)

>LU632_RS00695 fimbria/pilus periplasmic chaperone (Erwinia tracheiphila SCR3)
MLVKIAYSVFLMLCLVAQGNAAMTISGTRIIFPGSEKEVNVRTNNRGSNPALVQVWVDDG
NANGDVNTMKIPFMTTPPVYRVEPGKGQSVRLIYNGMALPQDRESLFWFNLLEVPPVVKG
MDNVDRLELAFRTRIKIFYRPKSLSGSGTNEVDKLKWEILSNNKGVRVTNPTPYYLSFDS
VSAEIGGKSVVLTPDMIKPFGSSDFLLENKGIISGLTSVKFKLINDYGSTYNGQLNLAGG
KELVLQKK