Protein Info for LU632_RS00690 in Erwinia tracheiphila SCR3

Annotation: type 1 fimbrial protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00419: Fimbrial" amino acids 28 to 182 (155 residues), 57.9 bits, see alignment E=1.5e-19 PF16970: FimA" amino acids 51 to 183 (133 residues), 48.4 bits, see alignment E=1.2e-16

Best Hits

Swiss-Prot: 37% identical to FMF3_ECOLX: F17 fimbrial protein (F17a-A) from Escherichia coli

KEGG orthology group: K07345, major type 1 subunit fimbrin (pilin) (inferred from 53% identity to cro:ROD_27801)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (183 amino acids)

>LU632_RS00690 type 1 fimbrial protein (Erwinia tracheiphila SCR3)
MRNFNVAVCVLTLGMAVSAQAVTQGTVEFDGKLITETCSIDTDSQAIIVNLPTLSTQTLS
DAGAVGGSRSFDIKVSDCPTGEGAAITKVAAHFEAIGGTGVNSVTGNLTNAYTGTEPKAT
NVEVRLFDADGATQLALGNTGTAFDIDSKAGTATMRYYGAYYATGATTPGKVYAKAQYTL
AYP