Protein Info for LU632_RS00505 in Erwinia tracheiphila SCR3

Annotation: EscU/YscU/HrcU family type III secretion system export apparatus switch protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 transmembrane" amino acids 28 to 45 (18 residues), see Phobius details amino acids 69 to 94 (26 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details amino acids 172 to 203 (32 residues), see Phobius details TIGR01404: type III secretion protein, YscU/HrpY family" amino acids 2 to 340 (339 residues), 358.1 bits, see alignment E=2.7e-111 PF01312: Bac_export_2" amino acids 3 to 336 (334 residues), 292.7 bits, see alignment E=2e-91

Best Hits

KEGG orthology group: K03229, type III secretion protein SctU (inferred from 69% identity to eam:EAMY_0788)

Predicted SEED Role

"Type III secretion inner membrane protein (YscU,SpaS,EscU,HrcU,SsaU, homologous to flagellar export components)" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (363 amino acids)

>LU632_RS00505 EscU/YscU/HrcU family type III secretion system export apparatus switch protein (Erwinia tracheiphila SCR3)
MAEKTEKPTEKKKRTSAKKGQTFKSKDLITTVMLITGIYFLPELIDFRRFIELYTFISLY
DKDMNVNSYMFLLFRIFIAMALPFIVVCCLAGYITTLLQTRFVIATEAIKLNFQALNPVK
GFKKIFSMRTVKEFIKSILYLVVFLCTSYLLIRGDLRLALSAYNATLPQMIGIWTGLIIK
AVILFIVCSIIVLVIDFIVEYFLHFKDLKMDKHEVKQEYKESDGNPEIKGARRQFHQEIL
SGENMAAIRNSAVVMANPTHIAVAIYFNPEMASLPFIALRVSNMKAQAAIAYAEKIGVPV
VRYVPLARKLYRTYRQYSFISIDDDVLMEVMDVLIWLRQVEMSGVPSVQDRGEEPEKGSD
SQP