Protein Info for LU632_RS00425 in Erwinia tracheiphila SCR3

Name: sctJ
Annotation: type III secretion inner membrane ring lipoprotein SctJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 210 to 232 (23 residues), see Phobius details TIGR02544: type III secretion apparatus lipoprotein, YscJ/HrcJ family" amino acids 7 to 197 (191 residues), 208.5 bits, see alignment E=3.8e-66 PF01514: YscJ_FliF" amino acids 23 to 189 (167 residues), 60.1 bits, see alignment E=1.3e-20

Best Hits

KEGG orthology group: K03222, type III secretion protein SctJ (inferred from 61% identity to eay:EAM_2672)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (256 amino acids)

>LU632_RS00425 type III secretion inner membrane ring lipoprotein SctJ (Erwinia tracheiphila SCR3)
MLKKLLRILSFFTIVLLLSACKEKAILDNLTQEQANQVLAILQQHNISADKSGTLKAGYS
ITVNNSDITVALSVINQYQLPWAADVQIRQAFPDSSLVASPNAEQARVISLQEQRLEQTL
RIVAQVVNAKVHISYPPFDNGSANKRPSAHVGILISYKGEMDENTFVSKIKSLIKNSIND
VRYENISIVLFPASTIQYSSPTKLPEAMPGLWEIIISLIIIFALIITGYLIFKSSQTGLT
KKELVSESGGEGVNQK