Protein Info for LU632_RS00275 in Erwinia tracheiphila SCR3

Name: dppC
Annotation: dipeptide ABC transporter permease DppC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 32 to 53 (22 residues), see Phobius details amino acids 100 to 127 (28 residues), see Phobius details amino acids 146 to 173 (28 residues), see Phobius details amino acids 216 to 244 (29 residues), see Phobius details amino acids 264 to 286 (23 residues), see Phobius details PF12911: OppC_N" amino acids 17 to 69 (53 residues), 62.8 bits, see alignment 2.1e-21 PF00528: BPD_transp_1" amino acids 116 to 299 (184 residues), 103.3 bits, see alignment E=1.4e-33

Best Hits

Swiss-Prot: 85% identical to DPPC_ECOLI: Dipeptide transport system permease protein DppC (dppC) from Escherichia coli (strain K12)

KEGG orthology group: K12370, dipeptide transport system permease protein (inferred from 92% identity to ebi:EbC_44070)

MetaCyc: 85% identical to dipeptide ABC transporter membrane subunit DppC (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>LU632_RS00275 dipeptide ABC transporter permease DppC (Erwinia tracheiphila SCR3)
MSLVDSGSVTAAPKPMTPFQEFWHYFKRNKGAVAGLVYVVLMFLIAVFANFLAPHAPAEQ
FREALLHPPVWQKGGSWQFILGTDDVGRDVLSRLMYGARLSLLVGCLVVVLSLILGVIFG
LIAGYVGSATDAIIMRLVDIMLALPSLLLALVLVAIFGPSIINASVALTFVALPHYIRLT
RAAVLVEVSRDYVTASGVAGAGAVRQMFVNILPNCLAPLIVQASLGFSNAILDMAALGFL
GMGAQPPTPEWGTMLSDVLQYAQSAWWVVTFPGVAILLTVLAFNLMGDGLRDALDPKLKQ