Protein Info for LRK53_RS18635 in Rhodanobacter sp000427505 FW510-R12

Annotation: glycosyltransferase family 2 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 transmembrane" amino acids 183 to 199 (17 residues), see Phobius details amino acids 212 to 230 (19 residues), see Phobius details amino acids 237 to 259 (23 residues), see Phobius details amino acids 267 to 292 (26 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 7 to 182 (176 residues), 37.8 bits, see alignment E=1.8e-13 PF00535: Glycos_transf_2" amino acids 8 to 170 (163 residues), 106.9 bits, see alignment E=1.1e-34

Best Hits

Swiss-Prot: 47% identical to GTRB_BPSFX: Bactoprenol glucosyl transferase (gtrB) from Shigella phage SfX

KEGG orthology group: None (inferred from 63% identity to xal:XALc_2191)

MetaCyc: 47% identical to CPS-53 (KpLE1) prophage; bactoprenol glucosyl transferase (Escherichia coli K-12 substr. MG1655)
Phosphopolyprenol glucosyltransferase. [EC: 2.4.1.78]

Predicted SEED Role

"Glycosyltransferase"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.78

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (339 amino acids)

>LRK53_RS18635 glycosyltransferase family 2 protein (Rhodanobacter sp000427505 FW510-R12)
MAPSVRLTVVVPAYNEAEVLPLFHARLVGVLDGMALDARVIYVDDGSRDGTWLVLNRLMG
QDPRIGALRLSRNFGKEAALTAGLDAVTDEADAIVIIDADLQDPPELIPELLARWRAGYD
VVYATREHREGESWFKRATAHLFYRLMARMAAFNVPHDTGDFRLMSARAVAALRQLRERQ
RFMKGLFGWIGYPHTAVMYQRSPRQAGRTKWNYWRLFNLAVEGITSFSILPLRLATAVGV
ATSVCAFSYGAGVFIKAVLWGDPVKGYPSLMVVVLVLGGLQLLALGVLGEYLGRVYAEVK
QRPIYLIEAACQVLAMPSPRGTDTPPSVVAASLPIKDPR