Protein Info for LRK53_RS18600 in Rhodanobacter sp000427505 FW510-R12

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 33 to 56 (24 residues), see Phobius details amino acids 76 to 98 (23 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details amino acids 168 to 187 (20 residues), see Phobius details amino acids 216 to 235 (20 residues), see Phobius details amino acids 247 to 265 (19 residues), see Phobius details amino acids 283 to 314 (32 residues), see Phobius details amino acids 335 to 358 (24 residues), see Phobius details amino acids 364 to 385 (22 residues), see Phobius details PF07690: MFS_1" amino acids 12 to 348 (337 residues), 107 bits, see alignment E=5e-35 amino acids 265 to 388 (124 residues), 36.2 bits, see alignment E=1.8e-13

Best Hits

KEGG orthology group: None (inferred from 48% identity to nmu:Nmul_A0026)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (393 amino acids)

>LRK53_RS18600 MFS transporter (Rhodanobacter sp000427505 FW510-R12)
MRSTVSKTIIVLGFVSFLNELSSQIVAPLIPLLLVTTLGAGPVAMGLVDGVADAVASGVR
LWAGRRSDVRGRRRKIFVVMGYGLSSIARPLVGLALNWPVVMLLRSLDRVGKGVRGAPRD
ALVADATPAALRGHAYGINRALDYAGAVGGSLIAAAALLWISHRISVVIMLSAIPAALAL
VVLMTLVKDVPAKTIKPGTTPAPLRWRALTVPSRRFLTVFLLFAFASASESFILLRAHEI
GMGNVQVLLLWAVLCAVQAGVAWRAGKVSDRFNKVTVVASTWLAYGVGLLLFAFVENILG
LWIVVVVYALLSGIGEGAEKTLVSTLATEADRGTAFGWFTMISGLGAIPAGLMFGVIWQQ
STAGIAFGVFGVLAIVSGVLLWVILPTQRAATI