Protein Info for LRK53_RS18435 in Rhodanobacter sp000427505 FW510-R12

Annotation: replicative DNA helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 TIGR00665: replicative DNA helicase" amino acids 22 to 456 (435 residues), 569.4 bits, see alignment E=2.4e-175 PF00772: DnaB" amino acids 22 to 122 (101 residues), 100.3 bits, see alignment E=8.8e-33 PF03796: DnaB_C" amino acids 199 to 454 (256 residues), 378.4 bits, see alignment E=2.5e-117 PF13481: AAA_25" amino acids 205 to 377 (173 residues), 45.2 bits, see alignment E=1.3e-15

Best Hits

KEGG orthology group: K02314, replicative DNA helicase [EC: 3.6.4.12] (inferred from 62% identity to psu:Psesu_1675)

Predicted SEED Role

"Replicative DNA helicase (EC 3.6.1.-)" in subsystem DNA-replication (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.4.12

Use Curated BLAST to search for 3.6.1.- or 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (467 amino acids)

>LRK53_RS18435 replicative DNA helicase (Rhodanobacter sp000427505 FW510-R12)
MNAQLQDQPFSYEEPPRGLRVPPNSREAEQAVIGGLLLSTEALDTIAGVVSADDFYSRDH
RILFEAIVDLNEQGAPADAVTLSDWLGRHQHARGIEPSYVIHLANITPSAANIVAYAQIV
RDKATLRRLADVSTKITQDALAPYAADAEEIVQQAEQAIFKIAEGNATGRKEIHSSTDVS
RAAFQVLVHRYENRGQLTGVATGFADLDKLTAGLQPSDLVIVAARPSMGKTAFALNVAES
AAVTSKRAVVVFSMEMSASQLGLRLISSMGRIDAQHLRTGDLAEEDWPRVTEAVNKLTSA
KIFIDDTPSLSPGELRSRARRLHREQGGLALIVIDYLQLMQVPGNSENRATEISEISRSL
KALAKELNVPVVALSQLNRSLEQRADKRPVMSDLRESGAIEQDADLIMFIYRDEYYNRDS
EDKGFAEVIVGKQRNGPTDTVKLAFLGRYTRFENAHRGAEDTFTAGF