Protein Info for LRK53_RS18100 in Rhodanobacter sp000427505 FW510-R12

Annotation: hydroxymethylbilane synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01379: Porphobil_deam
  • amino acids 6 to 210 (205 residues), 266 bits, E=2.1e-83
• TIGR00212: hydroxymethylbilane synthase
  • amino acids 6 to 297 (292 residues), 329.9 bits, E=5.8e-103
• PF03900: Porphobil_deamC
  • amino acids 226 to 295 (70 residues), 46 bits, E=5.6e-16

Best Hits

Swiss-Prot: 68% identical to HEM3_STRMK: Porphobilinogen deaminase (hemC) from Stenotrophomonas maltophilia (strain K279a)

KEGG orthology group: K01749, hydroxymethylbilane synthase [EC: 2.5.1.61] (inferred from 67% identity to psu:Psesu_0244)

MetaCyc: 55% identical to hydroxymethylbilane synthase (Escherichia coli K-12 substr. MG1655)
Hydroxymethylbilane synthase. [EC: 2.5.1.61]

Predicted SEED Role

"Porphobilinogen deaminase (EC 2.5.1.61)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 2.5.1.61)

MetaCyc Pathways

• superpathway of heme b biosynthesis from glutamate (9/10 steps found)
• tetrapyrrole biosynthesis I (from glutamate) (6/6 steps found)
• superpathway of heme b biosynthesis from glycine (6/8 steps found)
• dipyrromethane cofactor biosynthesis (3/4 steps found)
• tetrapyrrole biosynthesis II (from glycine) (3/4 steps found)
• adenosylcobalamin biosynthesis II (aerobic) (12/33 steps found)
• superpathway of bacteriochlorophyll a biosynthesis (5/26 steps found)
• adenosylcobalamin biosynthesis I (anaerobic) (12/36 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.61

Protein Sequence (305 amino acids)

>LRK53_RS18100 hydroxymethylbilane synthase (Rhodanobacter sp000427505 FW510-R12)
MNPSTLRIATRKSALALWQAEHVASRLRATHPGLAVELVPLSTRGDEILDQPLATIGGKG
LFLKELEVAMLEGRADLAVHSLKDVPAQLEPGFALPAMLPRADAADAFVSNHYADLAALP
HGARVGTSSLRRQAQLRALRSDLVLLDLRGNVGTRLAKLDAGAYDAIVLACAGLERLDLA
VRIRSRLAAPDWLPAPGQAAIAIEARADQPGVLALLVALDDADTRLTVSAERAMNQALGG
SCTVPVGAWCMLGEHGLHLRGLVGDAAGGRLLRAEASGPSDQALALGRQVAADLLAQGAA
EFLGI