Protein Info for LRK53_RS18005 in Rhodanobacter sp000427505 FW510-R12

Annotation: GGDEF and EAL domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 830 TIGR00229: PAS domain S-box protein" amino acids 27 to 137 (111 residues), 23.2 bits, see alignment E=6.2e-09 amino acids 139 to 264 (126 residues), 85.4 bits, see alignment E=3.4e-28 amino acids 275 to 389 (115 residues), 34.1 bits, see alignment E=2.7e-12 PF08448: PAS_4" amino acids 27 to 131 (105 residues), 48.5 bits, see alignment E=3.3e-16 amino acids 154 to 258 (105 residues), 39.5 bits, see alignment E=2.1e-13 amino acids 275 to 389 (115 residues), 40.8 bits, see alignment E=8.3e-14 PF13426: PAS_9" amino acids 38 to 129 (92 residues), 22.9 bits, see alignment E=3.1e-08 amino acids 154 to 256 (103 residues), 46.2 bits, see alignment E=1.7e-15 amino acids 280 to 387 (108 residues), 25.4 bits, see alignment E=4.9e-09 PF13188: PAS_8" amino acids 143 to 192 (50 residues), 16.1 bits, see alignment 3e-06 PF00989: PAS" amino acids 146 to 254 (109 residues), 44 bits, see alignment E=7.3e-15 amino acids 274 to 385 (112 residues), 31.6 bits, see alignment E=5e-11 PF08447: PAS_3" amino acids 166 to 248 (83 residues), 44.9 bits, see alignment E=4e-15 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 397 to 558 (162 residues), 132.3 bits, see alignment E=1.4e-42 PF00990: GGDEF" amino acids 400 to 554 (155 residues), 143.4 bits, see alignment E=1.9e-45 PF00563: EAL" amino acids 577 to 808 (232 residues), 245.5 bits, see alignment E=1.8e-76

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (830 amino acids)

>LRK53_RS18005 GGDEF and EAL domain-containing protein (Rhodanobacter sp000427505 FW510-R12)
MRPHEPAEVSPSLPGEADWSARVAHGAPVLLAYLDLEQRFRFVNDTHRRWLGVDPQQLIG
QLLVDVVGRRNHALAKTALARAYAGQMASYEGELHDGSRRRYAHGNFQPDFDAGGRVCGI
FTALVDITERHDLELKLHESEQRFFGAFQHAAIGMALVAPDSRWLRVNAALCAMLGYRED
EFLSRKTRDITHPDDVATSDMRHAQMLEGELESCHLEKRYFHRNGSLVHAQLSVSLVRDD
DGSPRYFVVQIQDISQRKAFEDALHRERELAEVTLRSIGDAVITTDPQLCITSLNPIAEA
MTGWSGLEAQGRPIEEIFQLFDARSGHAVANPLRAAISHNTIVDLAGRTLLRHRHGFDTP
VEDSSAPIHDNAGNVIGGVLVFHDVSETRALALKMIHLTQHDTLTGLPNRSQLHEHIGQA
IATANRRQQRAALLYADIDNFKQVNELHGHAAGDRVLRAFAAQLQRCLSGDDLLSRYGGD
EFVVVLPHLESVGDAASLGQRLINHGEQTRVDGLAELGLRLSIGISVYPDDAIEPDGLLQ
HAETALVAVKAQGRHGYRFFTASMNERTQARRRIETALRQALPRHELELYYQPKVDVHSG
RIVGAEALLRWQANGRELYQPDQFVPVAEDSGLILPIGAWALRRACRQARAWQDLGHAIA
VSVNVSPLQFQHPEFYHWLDEVLVESGLAPGLLELELTERMVMSGGDATTGLLQRIKRRG
VRLSLDDFGTGYCSLSYLKHFPIDTLKIDRVFVRDLASDRDTATITSAIIAMARSLNKEV
VAEGVETHAQVAFLRQAGCSQLQGFLFGAALPAAEFQALLTGASTPTPDL