Protein Info for LRK53_RS17935 in Rhodanobacter sp000427505 FW510-R12

Annotation: 3-hydroxybutyrate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF23441: SDR" amino acids 2 to 259 (258 residues), 46.1 bits, see alignment E=8.9e-16 TIGR01963: 3-hydroxybutyrate dehydrogenase" amino acids 7 to 261 (255 residues), 328.4 bits, see alignment E=1.3e-102 PF00106: adh_short" amino acids 7 to 199 (193 residues), 180.7 bits, see alignment E=4.6e-57 PF08659: KR" amino acids 9 to 176 (168 residues), 40.2 bits, see alignment E=7e-14 PF13561: adh_short_C2" amino acids 13 to 258 (246 residues), 163.9 bits, see alignment E=1e-51

Best Hits

Swiss-Prot: 43% identical to BDHA_RHIME: D-beta-hydroxybutyrate dehydrogenase (bdhA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00019, 3-hydroxybutyrate dehydrogenase [EC: 1.1.1.30] (inferred from 80% identity to axy:AXYL_06209)

Predicted SEED Role

"D-beta-hydroxybutyrate dehydrogenase (EC 1.1.1.30)" in subsystem Polyhydroxybutyrate metabolism (EC 1.1.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (261 amino acids)

>LRK53_RS17935 3-hydroxybutyrate dehydrogenase (Rhodanobacter sp000427505 FW510-R12)
MNSLNGKVALVTGAASGLGKAIAELYASNGASVAIADINQQAADAVAAQINAAGGKALGV
AMDVTSEDAVNAGTDKVVATFGHLDILISNAGVQIINPIDQFAFADWKKMLAIHLDGGFL
TTKAALKHMYPGDRGGIVIYMGSVHSHEASKLKSAYVAAKHGLLGLARTLAKEGAPHNVR
SHVICPGFVRTPLVEKQIPEQAKELGISEDEVIRNVMLKDTVDGVFTTVEDIAQTALYLA
TFPSAALTGQSIVVSHGWFMQ