Protein Info for LRK53_RS17860 in Rhodanobacter sp000427505 FW510-R12

Annotation: peptidoglycan DD-metalloendopeptidase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 481 transmembrane" amino acids 52 to 73 (22 residues), see Phobius details PF04225: LysM_OapA" amino acids 107 to 177 (71 residues), 34.4 bits, see alignment E=4e-12 PF19425: Csd3_N2" amino acids 200 to 321 (122 residues), 38.2 bits, see alignment E=2.5e-13 PF01551: Peptidase_M23" amino acids 334 to 430 (97 residues), 114.1 bits, see alignment E=5.5e-37

Best Hits

KEGG orthology group: None (inferred from 44% identity to xal:XALc_0382)

Predicted SEED Role

"Peptidase, M23/M37 family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (481 amino acids)

>LRK53_RS17860 peptidoglycan DD-metalloendopeptidase family protein (Rhodanobacter sp000427505 FW510-R12)
MAEEKQGARQARKQAICRKAQRRHSHFYARCAHWSFNRSGEIEPIRWRRERLVLAGTALL
ITLLSGFIMPAWASAMRPAPTPEVHSLLPLALPKITPANLTAATVDDWQVVRVQPGQTLS
DIFTARGLGMADLQKVMDTAGSAKNALHNIRPGQEFDFLLGSDGSLKGFRFDQDQASRAT
IRLDGTRPSVAIQQRDMDLREQVAHGVIRSSLYAAGDQAGMDAAMVGKLADLFKYDIDFV
QDLRVGDSFTVIYDDIYRDGVRYGQGNIIAAEFVNQDKRYTAYRFKKADGSYGWYSEDGR
PIQKSFLRIPVDFTRISSQFTATRMHPILGRMRAHKGVDYAAPSGTPIHAAGDGVIKYHG
WERGYGNFVVIQHNNSISTAYGHMSRFVKGQRVGERVRQGEVIGYVGMTGLATGPHLHYE
FRVNGVQRNPQTVTLPKPEPLPAVQMARFKADVVKPQLARLTELDARITLARANVRANHD
N