Protein Info for LRK53_RS17800 in Rhodanobacter sp000427505 FW510-R12

Annotation: penicillin-binding protein 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 665 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details TIGR03423: penicillin-binding protein 2" amino acids 19 to 613 (595 residues), 723 bits, see alignment E=1.4e-221 PF03717: PBP_dimer" amino acids 64 to 233 (170 residues), 153.4 bits, see alignment E=9.4e-49 PF00905: Transpeptidase" amino acids 267 to 609 (343 residues), 225 bits, see alignment E=1.3e-70

Best Hits

Swiss-Prot: 42% identical to MRDA_SALTY: Peptidoglycan D,D-transpeptidase MrdA (mrdA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K05515, penicillin-binding protein 2 (inferred from 50% identity to xoo:XOO3968)

Predicted SEED Role

"Penicillin-binding protein 2 (PBP-2)" in subsystem Peptidoglycan Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (665 amino acids)

>LRK53_RS17800 penicillin-binding protein 2 (Rhodanobacter sp000427505 FW510-R12)
MKPRRSIKDPRGESLLFRRRALAGFVLIVLCLCLLVGRFVFLQVMRHDEFVTRSQANRVK
PRAIPPARGLIYDRNGVLLADNVPAFRLEVVPEQVKDMPALLARLGEVVPLDPGDLDAFR
KQLKQSRRFESVPLKLHLTEDEIARFAVNRWRFPGVDVVPYLTRRYPLRGLFAHVVGYVG
RIDADDLERLDPKRYQGTSHVGRSGIERSYENILHGTPGYELLEVNADGRTQRVLETHAP
TPGRNLYLSLDVRLQKAAEAAFEGRPGAAVAIDPRNGQVLAMVSVPSFDPNLFVNGIGQA
DYAALTNDPEKPLYNRALRGVYPPGSTVKPLIGLAGLETGMRTPQDTVVSTGVFYIPGQQ
RGYRDDQRGGVGRVDLVGAIEQSVNTYFYKLALDMGIDRFSGYMGKFGFGRPTGIDLVGE
SSGVLPSREWKAANFRQPWYPGETVIAGIGQGYWAVTPLQLGHAIATFAGHGVPYAPRLA
MATQGGVNAAPQPLANPPSGPSVIRKPADWDVVNQGMQQVIYGARGTGRQLGVGFPYLMA
GKSGTAERFSRRSEAYDTNRSTEYLATRHRAWFVAYAPADNPQIAVAAILESGAWGASAA
GPIVRTILDTWLASHGGEIADAKRLSVSAAPLPPIARNAPPDAGVEDSEPVEDLPTPATS
SGGTP