Protein Info for LRK53_RS17695 in Rhodanobacter sp000427505 FW510-R12

Annotation: MT-A70 family methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF05063: MT-A70" amino acids 72 to 241 (170 residues), 94.3 bits, see alignment E=8.4e-31 PF19575: HTH_58" amino acids 271 to 325 (55 residues), 36.5 bits, see alignment E=3.8e-13

Best Hits

KEGG orthology group: None (inferred from 69% identity to sch:Sphch_2565)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (326 amino acids)

>LRK53_RS17695 MT-A70 family methyltransferase (Rhodanobacter sp000427505 FW510-R12)
MKLRPKPIVAAPFWPVLAPDAVLGMSVKTYWRGGSRSTKLHSEDLNSGEEMVRPLVEQTH
NVALPPIDGGWSTILADPPWRFTNRTGKVAPEHRRLDRYSTMDLNEICAMPVQAVAAKNS
HLYLWVPNALLPDGLRVMQAWGFRYISNIVWAKRRKDGGPDGRGVGFYFRNVTELLLFGV
RGSLRTLAPARSQVNMIETRKREHSRKPDEQYALIEDCSPGPYLELFARHAHLGWTVWGA
ESAATVEPRGKQHKGYTGGPIQLPLIPAHGRLSEDQAEYIGRVLKQKYDNGCSIRELSEE
TAYSITRVRALLDAADTKLRARGGSR