Protein Info for LRK53_RS17455 in Rhodanobacter sp000427505 FW510-R12

Annotation: cardiolipin synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 35 to 55 (21 residues), see Phobius details amino acids 110 to 129 (20 residues), see Phobius details TIGR04265: cardiolipin synthase" amino acids 106 to 464 (359 residues), 317.3 bits, see alignment E=1e-98 PF00614: PLDc" amino acids 205 to 226 (22 residues), 28.2 bits, see alignment (E = 1.4e-10) amino acids 378 to 404 (27 residues), 23.6 bits, see alignment (E = 3.9e-09) PF13091: PLDc_2" amino acids 306 to 431 (126 residues), 96.1 bits, see alignment E=1.6e-31

Best Hits

KEGG orthology group: K06131, cardiolipin synthase [EC: 2.7.8.-] (inferred from 57% identity to bur:Bcep18194_A5343)

Predicted SEED Role

"Cardiolipin synthetase (EC 2.7.8.-)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (464 amino acids)

>LRK53_RS17455 cardiolipin synthase (Rhodanobacter sp000427505 FW510-R12)
MTASLLTACIAAAHLLGLFAAMHAVMHMRTPQGAVGWTLGLLLLPYVTLLPYLYLGSSRF
LGYRAGHRAPAAPALSTTADAAAPVDPGCERYAAISALQRRPFRSGHRLRLLIDGTAAFE
AMLGAMAGARHSLLVQFFIIHDDTLGRRLQQVLLERAAAGVRVCVLFDGIGSHALPQQYV
ETLRAGGVAIHRFATRRWRNRFQLNFRNHRKILVVDGTRGFVGGLNAGDEYLGLKPPLAP
WRDTQLELAGPAVADLQQLFADDWHWITGTALPLCPVPPADGNASALVVACGPADPQETG
SLFFAAAINAARQRVWLSTPYFVPDHAVRAALQLAVLRGVDVRVLIPARPDHRTVFLAST
LHAYAAVRAGIRVFRYQPGFLHQKALLIDRDTAAIGSLNLDSRSFRLNFEVAALAVDHAF
AAEVAAMFNADFTRAKAIDEREYREAPYLHRVAMHVARLFDPLL