Protein Info for LRK53_RS17260 in Rhodanobacter sp000427505 FW510-R12

Annotation: 4Fe-4S binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 transmembrane" amino acids 31 to 53 (23 residues), see Phobius details amino acids 72 to 90 (19 residues), see Phobius details amino acids 123 to 143 (21 residues), see Phobius details amino acids 149 to 168 (20 residues), see Phobius details amino acids 273 to 293 (21 residues), see Phobius details amino acids 343 to 365 (23 residues), see Phobius details amino acids 377 to 398 (22 residues), see Phobius details amino acids 409 to 431 (23 residues), see Phobius details amino acids 442 to 462 (21 residues), see Phobius details PF12801: Fer4_5" amino acids 73 to 113 (41 residues), 34.9 bits, see alignment 6.3e-13 amino acids 158 to 191 (34 residues), 17.8 bits, see alignment 1.3e-07

Best Hits

KEGG orthology group: None (inferred from 61% identity to eba:ebA1869)

Predicted SEED Role

"Ferredoxin" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (463 amino acids)

>LRK53_RS17260 4Fe-4S binding protein (Rhodanobacter sp000427505 FW510-R12)
MNRAPISDAASGAGTARLARLGLAMRRHRKLILGIQWVVVLGYTVLVCVPAFLPLPPEQA
HVWNNLTRFAQFVFWGIWWPFVILSIMLLGRMWCGVLCPEGALTEWASGFGLGRGIPRWM
KWSGWPFVAFVMTTVFGQMTSVYDYPKPALLILGGSTVAAIATGLVWGREKRIWCRHLCP
VSGVFGLLAKIAPLHFSVDQAAWDTAPAGHRTSRKHPVNCAPMIDIRRMQSASACHMCGR
CAGERGAVTLAARSPSTEILAARSGMTDADKWPVRLLIFGMLGVALGAFQWSASPWLVAA
KQAVAGWLIDRQAWWPLNDVGHWWLFTDYPEANDAFTWLDGGLLLAYIAAETILVGGWIR
LWLHLAERLSGLYWRRLAYTLIPFAGASLFVGLSLLTSAQLHGEGIALPWANGVRMALLT
MAGAWSTRLAWRLAPRRRLPSMAAILAAVALPYAAWGTQFFLW