Protein Info for LRK53_RS17250 in Rhodanobacter sp000427505 FW510-R12

Annotation: peptide MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 502 transmembrane" amino acids 38 to 57 (20 residues), see Phobius details amino acids 70 to 88 (19 residues), see Phobius details amino acids 97 to 114 (18 residues), see Phobius details amino acids 119 to 138 (20 residues), see Phobius details amino acids 159 to 179 (21 residues), see Phobius details amino acids 191 to 211 (21 residues), see Phobius details amino acids 232 to 250 (19 residues), see Phobius details amino acids 256 to 276 (21 residues), see Phobius details amino acids 287 to 305 (19 residues), see Phobius details amino acids 336 to 356 (21 residues), see Phobius details amino acids 368 to 391 (24 residues), see Phobius details amino acids 397 to 420 (24 residues), see Phobius details amino acids 432 to 455 (24 residues), see Phobius details amino acids 475 to 494 (20 residues), see Phobius details TIGR00924: amino acid/peptide transporter (Peptide:H+ symporter)" amino acids 19 to 498 (480 residues), 351.9 bits, see alignment E=3.3e-109 PF07690: MFS_1" amino acids 40 to 374 (335 residues), 53.2 bits, see alignment E=2.4e-18 PF00854: PTR2" amino acids 96 to 458 (363 residues), 210.8 bits, see alignment E=3.1e-66

Best Hits

KEGG orthology group: K03305, proton-dependent oligopeptide transporter, POT family (inferred from 66% identity to xfa:XF1891)

Predicted SEED Role

"Di-/tripeptide transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (502 amino acids)

>LRK53_RS17250 peptide MFS transporter (Rhodanobacter sp000427505 FW510-R12)
MGNTTLSGDARPVPDYPQLLGHPRPLWMLFMSEFWERFAFYGMRWALTLYIVAQFYGGND
TGQADASRTYGAYLALVYATAVFGGYVADKILGYQRSILLGAVVMAAGLFMVMVPNHAVF
MLGLATIIVGNGLFKPNISSMVGQLYAQGDSRRDRGFTLFYMGINAGALIAPVLTSILAN
KVFGTPGHHNYQVVFAASGVGMLISLVWFWFGRRQLGPVGRPAPEQASRMRVVYVVLGVL
AAIPLVYLLMDKAGAVAIQWLLSVLFLGVGVMLVVEAIRTGRVQIQRVIAMLIIFTFNVL
FWMFFEQAGSSFNFLAQHIVDRNLGGWEFPIGWFQSVNPVAIVLLAPLISLVWGWLDKRG
AEPSIPRKFGLGLIGNALGFAVLMYALSALVGGDGMIPLWTLALCYVLQTAGELCLSPIG
LSMVTKLAPVRLVGLGMGGWFLSTAIGNNLAGLFAGHVSGETGMTVDSALSGYTMGFWIL
LGGGIVLFLVAPLINRLMHGVR