Protein Info for LRK53_RS17245 in Rhodanobacter sp000427505 FW510-R12

Annotation: peptide MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 503 transmembrane" amino acids 38 to 57 (20 residues), see Phobius details amino acids 67 to 87 (21 residues), see Phobius details amino acids 97 to 114 (18 residues), see Phobius details amino acids 120 to 138 (19 residues), see Phobius details amino acids 159 to 179 (21 residues), see Phobius details amino acids 191 to 211 (21 residues), see Phobius details amino acids 232 to 252 (21 residues), see Phobius details amino acids 258 to 276 (19 residues), see Phobius details amino acids 288 to 308 (21 residues), see Phobius details amino acids 329 to 358 (30 residues), see Phobius details amino acids 370 to 388 (19 residues), see Phobius details amino acids 400 to 422 (23 residues), see Phobius details amino acids 433 to 455 (23 residues), see Phobius details amino acids 468 to 494 (27 residues), see Phobius details TIGR00924: amino acid/peptide transporter (Peptide:H+ symporter)" amino acids 19 to 499 (481 residues), 354.2 bits, see alignment E=6.9e-110 PF07690: MFS_1" amino acids 38 to 311 (274 residues), 73.9 bits, see alignment E=1.2e-24 PF00854: PTR2" amino acids 96 to 457 (362 residues), 209 bits, see alignment E=1.2e-65

Best Hits

KEGG orthology group: K03305, proton-dependent oligopeptide transporter, POT family (inferred from 59% identity to xfm:Xfasm12_1074)

Predicted SEED Role

"Di-/tripeptide transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (503 amino acids)

>LRK53_RS17245 peptide MFS transporter (Rhodanobacter sp000427505 FW510-R12)
MSQTSAAGDAVPRPDYPQLLGHPRPLWMLFMTEFWERFAYYSVSWALVLYIVAQFFHGDS
AGQGWAAGVYGAYTALIYAASIFGGYVADRVIGYQRSILLGAAVMAAGLFTLLLPSKPLM
MLGLALVIAGDGLFKPNISTMVGQLYGRDDPRRDRGFTLFYMGINAGAFVAPLLTGWMAA
TFTDTPMQQNYRVVFAAAGVGMLLSFLWFWFGRRNLKDVGRPLPGMENRARVLWVLLGAA
VAVPLIYALLAYVGADGLQWLLGALFIGVAAALIVEARRHDRVQLHRVIAMLIVFGFSVV
FWTFYFQFGTSLNFLAENWVDREMFGGWIFPVGWFQSVTPLAILVFAPLLTLVWGMFARR
HAEPSIPRKFGFGLIFNGLGFVVLVYALKELLGPTGLIPFWPLVLCYVMQTLGELCLSPI
GLSMVTKLAPPRFVGLAMGGWFLSLAGGGDFSGLVARSISGTHGMTVASALAGFNFCLWV
LLGSGALLLAISPLINRLMHGVR