Protein Info for LRK53_RS17185 in Rhodanobacter sp000427505 FW510-R12

Annotation: copper-containing nitrite reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 507 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR02376: nitrite reductase, copper-containing" amino acids 57 to 356 (300 residues), 368.7 bits, see alignment E=1.5e-114 PF07732: Cu-oxidase_3" amino acids 87 to 198 (112 residues), 41.8 bits, see alignment E=3.2e-14 PF07731: Cu-oxidase_2" amino acids 108 to 197 (90 residues), 20.6 bits, see alignment E=9.7e-08 PF00127: Copper-bind" amino acids 111 to 195 (85 residues), 22.6 bits, see alignment E=3.5e-08 PF00394: Cu-oxidase" amino acids 206 to 336 (131 residues), 23.2 bits, see alignment E=1.9e-08 PF13442: Cytochrome_CBB3" amino acids 392 to 476 (85 residues), 33.2 bits, see alignment E=1.6e-11 PF00034: Cytochrom_C" amino acids 393 to 480 (88 residues), 45.4 bits, see alignment E=5.3e-15

Best Hits

KEGG orthology group: K00368, nitrite reductase (NO-forming) [EC: 1.7.2.1] (inferred from 80% identity to rso:RS03038)

Predicted SEED Role

"Copper-containing nitrite reductase (EC 1.7.2.1)" in subsystem Denitrification (EC 1.7.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.7.2.1

Use Curated BLAST to search for 1.7.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (507 amino acids)

>LRK53_RS17185 copper-containing nitrite reductase (Rhodanobacter sp000427505 FW510-R12)
MLRSPLLAVAAAAMLALAACSGKPSAVSPVGEADASSSPAAIAATRGDFGPPQGEPIHAV
LTSPPHVPPPVNRNHPAKVIVELEVVEKEMPISEGVSYTFWTFGGTVPGSFIRVRQGDTV
EFHLKNAPDSKMPHNIDLHGVTGPGGGAASSFTAPGHASQFTFKALNQGIYVYHCATAPV
GMHIANGMYGLILVEPPEGLPKVDHEYYVMQGDFYTTGKYRQKGHQPFDMEKAIDEHPTY
VLFNGKEGALTGDNALTAKTDQTVRLFVGNGGPNLVSSFHVIGEIFDKVQPEGGTVAQHN
VQTTLIPAGGAAMVEFHTDVPGSYVLVDHSIFRAFNKGALGILKVDGPEDKTIYSGKEVD
SVYLGDRSEPNLQAVTTAAKAHAAGTLTKAEQIAAGKQLFTGTCSVCHQANGEGLANVFP
PLAKSDYLAVDPKRAMTIVTHGLTGKVTVNGHEYDSVMPPMAQLTDDEVANILTYVLNSW
GNPGGQISKEEVAKARAAVTPAATAEH