Protein Info for LRK53_RS16775 in Rhodanobacter sp000427505 FW510-R12

Annotation: lipid asymmetry maintenance ABC transporter permease subunit MlaE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 transmembrane" amino acids 15 to 34 (20 residues), see Phobius details amino acids 47 to 69 (23 residues), see Phobius details amino acids 74 to 95 (22 residues), see Phobius details amino acids 101 to 123 (23 residues), see Phobius details amino acids 148 to 178 (31 residues), see Phobius details amino acids 198 to 220 (23 residues), see Phobius details amino acids 234 to 257 (24 residues), see Phobius details TIGR00056: ABC transport permease subunit" amino acids 13 to 257 (245 residues), 258.4 bits, see alignment E=4.3e-81 PF02405: MlaE" amino acids 44 to 255 (212 residues), 231.9 bits, see alignment E=3.3e-73

Best Hits

Swiss-Prot: 55% identical to MLAE_SHIFL: Intermembrane phospholipid transport system permease protein MlaE (mlaE) from Shigella flexneri

KEGG orthology group: K02066, putative ABC transport system permease protein (inferred from 59% identity to tbd:Tbd_1899)

Predicted SEED Role

"Uncharacterized ABC transporter, permease component YrbE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (258 amino acids)

>LRK53_RS16775 lipid asymmetry maintenance ABC transporter permease subunit MlaE (Rhodanobacter sp000427505 FW510-R12)
MNARAPRPRNVLTQSLAQIGACGLFLLTLLAAVPRSFRYLRETIRQLWFVGAMSLTIIMV
CGLFVGMVLMLQLYHVLSIFGGTSASGMVVALSVYRELGPVVTALLFAGRAGTAVTAEIG
LMRATDQISAMEMMAVDPVAYVATPRFLAGLIAMPLLSCVFCAMAIFGGHLVGVTWLGID
NGTFWSNMTAQVDVRTDIVNGVLLKSLAFGAVVSLIAVFQGFTTPPTSEGVAYATTRTVV
ASSIAILALDFVLTAFLM