Protein Info for LRK53_RS16635 in Rhodanobacter sp000427505 FW510-R12

Annotation: efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 122 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 2 to 117 (116 residues), 108.1 bits, see alignment E=2.2e-35 PF25944: Beta-barrel_RND" amino acids 2 to 40 (39 residues), 52.7 bits, see alignment E=9.6e-18 PF25967: RND-MFP_C" amino acids 50 to 107 (58 residues), 55.6 bits, see alignment E=8.2e-19 PF25975: CzcB_C" amino acids 51 to 107 (57 residues), 31.6 bits, see alignment E=2.6e-11

Best Hits

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (122 amino acids)

>LRK53_RS16635 efflux RND transporter periplasmic adaptor subunit (Rhodanobacter sp000427505 FW510-R12)
MAGTLEFVDNAVDATTGTIVLKARFDNGEHPLTPGQFVRVMPPTTRLAGVVSVPVQALQS
SSSGSFVFVLGTDGKVQQRYVTPGPTSAGRAVIDKGLKAGEQVVTEGQMLLVDGSAATVK
RS