Protein Info for LRK53_RS16585 in Rhodanobacter sp000427505 FW510-R12

Annotation: TIGR00366 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 52 to 77 (26 residues), see Phobius details amino acids 95 to 122 (28 residues), see Phobius details amino acids 137 to 159 (23 residues), see Phobius details amino acids 185 to 209 (25 residues), see Phobius details amino acids 240 to 260 (21 residues), see Phobius details amino acids 271 to 291 (21 residues), see Phobius details amino acids 303 to 327 (25 residues), see Phobius details amino acids 342 to 367 (26 residues), see Phobius details amino acids 407 to 424 (18 residues), see Phobius details amino acids 435 to 457 (23 residues), see Phobius details PF02667: SCFA_trans" amino acids 2 to 448 (447 residues), 305.3 bits, see alignment E=8.8e-95 PF03606: DcuC" amino acids 334 to 451 (118 residues), 23.3 bits, see alignment E=2.2e-09

Best Hits

KEGG orthology group: K02106, short-chain fatty acids transporter (inferred from 79% identity to smt:Smal_3807)

Predicted SEED Role

"Short chain fatty acids transporter" in subsystem Polyhydroxybutyrate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (462 amino acids)

>LRK53_RS16585 TIGR00366 family protein (Rhodanobacter sp000427505 FW510-R12)
MAHMALRSAAWAERWFPDAWVFAALGVVVVALAAFAFGATPTATVTAFGDGFWSLIPFTM
QMAFVVIGGYVLATAPVVARFIDVLARAPRSGRGAVVYIALVSMLASLLSWGFSLVFGGL
LVRALARRDDLRMDYRAAGAAAYLGLGAIWAMGLSSSAAQLQANPASMPPGLLAITGVLP
FSQTIFLWQSIVLTTVLIVVSLLICWYTAPSDANARTSKDFDIGESSTPALPPRTRPGEW
LEYSPLLALAIGLLGLGWLGHEFASKPAVTAIANLNTYNFLFLTLGILLHWRPRSFLDAV
SRAVPSTSGVLIQFPLYGGIAALLTHVPGSDGATLAHRLSNLFVHIAGTESFPAVMGAYS
AILGFFVPSGGGKWLVEAPYVIQAANDLHVHLGWAVQVYNAAEALPNLINPFWMLPLLGV
LGLKARDVVGYTFMQLVVHVPLVLGMLWLLGLTLTYVPPVMP