Protein Info for LRK53_RS16440 in Rhodanobacter sp000427505 FW510-R12

Annotation: enoyl-CoA hydratase-related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Predicted SEED Role

"Enoyl-CoA hydratase (EC 4.2.1.17)" in subsystem Acetyl-CoA fermentation to Butyrate or Butanol Biosynthesis or Isoleucine degradation or Polyhydroxybutyrate metabolism or Valine degradation or n-Phenylalkanoic acid degradation (EC 4.2.1.17)

MetaCyc Pathways

oleate β-oxidation (32/35 steps found)
fatty acid β-oxidation I (generic) (6/7 steps found)
superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
benzoyl-CoA biosynthesis (3/3 steps found)
fatty acid salvage (5/6 steps found)
adipate degradation (4/5 steps found)
L-isoleucine degradation I (4/6 steps found)
pyruvate fermentation to butanol II (engineered) (4/6 steps found)
1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
adipate biosynthesis (3/5 steps found)
fatty acid β-oxidation II (plant peroxisome) (3/5 steps found)
fatty acid β-oxidation IV (unsaturated, even number) (3/5 steps found)
glutaryl-CoA degradation (3/5 steps found)
L-tryptophan degradation III (eukaryotic) (10/15 steps found)
pyruvate fermentation to hexanol (engineered) (7/11 steps found)
2-methyl-branched fatty acid β-oxidation (9/14 steps found)
methyl ketone biosynthesis (engineered) (3/6 steps found)
propanoate fermentation to 2-methylbutanoate (3/6 steps found)
superpathway of Clostridium acetobutylicum acidogenic fermentation (5/9 steps found)
valproate β-oxidation (5/9 steps found)
3-hydroxypropanoate/4-hydroxybutanate cycle (11/18 steps found)
fatty acid β-oxidation VI (mammalian peroxisome) (3/7 steps found)
pyruvate fermentation to butanoate (3/7 steps found)
3-phenylpropanoate degradation (5/10 steps found)
L-glutamate degradation V (via hydroxyglutarate) (5/10 steps found)
glycerol degradation to butanol (9/16 steps found)
benzoate biosynthesis III (CoA-dependent, non-β-oxidative) (1/5 steps found)
L-valine degradation I (3/8 steps found)
pyruvate fermentation to butanol I (3/8 steps found)
(8E,10E)-dodeca-8,10-dienol biosynthesis (5/11 steps found)
benzoyl-CoA degradation I (aerobic) (2/7 steps found)
benzoate biosynthesis I (CoA-dependent, β-oxidative) (3/9 steps found)
superpathway of Clostridium acetobutylicum solventogenic fermentation (5/13 steps found)
phenylacetate degradation I (aerobic) (2/9 steps found)
gallate degradation III (anaerobic) (3/11 steps found)
superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (7/17 steps found)
L-glutamate degradation VII (to butanoate) (3/12 steps found)
superpathway of phenylethylamine degradation (2/11 steps found)
(4Z,7Z,10Z,13Z,16Z)-docosapentaenoate biosynthesis (6-desaturase) (2/13 steps found)
docosahexaenoate biosynthesis III (6-desaturase, mammals) (2/14 steps found)
crotonate fermentation (to acetate and cyclohexane carboxylate) (3/16 steps found)
benzoate fermentation (to acetate and cyclohexane carboxylate) (3/17 steps found)
toluene degradation VI (anaerobic) (3/18 steps found)
platensimycin biosynthesis (7/26 steps found)
Spodoptera littoralis pheromone biosynthesis (3/22 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.2.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (215 amino acids)

>LRK53_RS16440 enoyl-CoA hydratase-related protein (Rhodanobacter sp000427505 FW510-R12)
MADSSEILSDVEARVMTPSFNRVARKNSITSTMYTRLAEALEQAVDDASVHVVLILGDAS
IFTAGNDIADFIEQIEASIKPPQIAPPLMRFLRLLAAFPKPLVAAVCGPAVGIGTTLLFH
SDLVCAGDNTKFATPFVIWAWCPSWHQACSRRRYWAITGRLKLALAQARKLADKPSSALV
ETKRLMKLARQSAVQQRLEGREHQLWTDDARPGGA