Protein Info for LRK53_RS16420 in Rhodanobacter sp000427505 FW510-R12

Annotation: hydroxymethylglutaryl-CoA lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 PF00682: HMGL-like" amino acids 7 to 275 (269 residues), 149.1 bits, see alignment E=8.2e-48

Best Hits

Swiss-Prot: 44% identical to HMGCL_BACSU: Hydroxymethylglutaryl-CoA lyase YngG (yngG) from Bacillus subtilis (strain 168)

KEGG orthology group: K01640, hydroxymethylglutaryl-CoA lyase [EC: 4.1.3.4] (inferred from 48% identity to abo:ABO_2665)

MetaCyc: 45% identical to hydroxymethylglutaryl-CoA lyase monomer (Pseudomonas sp. mevalonii)
Hydroxymethylglutaryl-CoA lyase. [EC: 4.1.3.4]

Predicted SEED Role

"Hydroxymethylglutaryl-CoA lyase (EC 4.1.3.4)" in subsystem HMG CoA Synthesis or Leucine Degradation and HMG-CoA Metabolism (EC 4.1.3.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.3.4

Use Curated BLAST to search for 4.1.3.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (307 amino acids)

>LRK53_RS16420 hydroxymethylglutaryl-CoA lyase (Rhodanobacter sp000427505 FW510-R12)
MSTVDVVINEVGPRDGLQNQARVLDVAERITMIQALVDAGLRSVEAGSFVSPKAVPQMAN
TVAVFAQLPRPDLVRYSALIPNARGYELASVAGARTLSVVLSATETMNRRNINLSLEQTT
VICAELMRRAREDDIQGWAYLAVAYECPFEGETPVARVERLAAKMIEAGADKLIVADTIG
AANPAQVHLLISRLVASYGAERIACHFHDTRGMALANVLAALDEGIRAFDSSIGGLGGCP
FSPGASGNVATEDVVLMIESMGLRTGIDPLALVAVVDHCSELLGSPLGGHAYNWLKRQAT
QKAGRLA