Protein Info for LRK53_RS16310 in Rhodanobacter sp000427505 FW510-R12

Annotation: YraN family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 118 TIGR00252: TIGR00252 family protein" amino acids 1 to 106 (106 residues), 111.1 bits, see alignment E=1.7e-36 PF02021: UPF0102" amino acids 9 to 98 (90 residues), 94.6 bits, see alignment E=2e-31

Best Hits

Swiss-Prot: 52% identical to Y1070_PSEU5: UPF0102 protein PST_1070 (PST_1070) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K07460, putative endonuclease (inferred from 54% identity to xal:XALc_2826)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (118 amino acids)

>LRK53_RS16310 YraN family protein (Rhodanobacter sp000427505 FW510-R12)
MRAAGDDFEQRACGELERAGLKLLARNYTTRHGELDLVMRDGDAVVFVEVRYRRSASHGD
AVASVTAAKQAKLILAAQHWLAAHPQHARRNCRFDVVSYDGPPEAIRREWLRGAFEAG