Protein Info for LRK53_RS16300 in Rhodanobacter sp000427505 FW510-R12
Annotation: 16S rRNA (cytidine(1402)-2'-O)-methyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 64% identical to RSMI_PSEAE: Ribosomal RNA small subunit methyltransferase I (rsmI) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
KEGG orthology group: K07056, (no description) (inferred from 66% identity to xcc:XCC0712)MetaCyc: 51% identical to 16S rRNA 2'-O-ribose C1402 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11637 [EC: 2.1.1.198]
Predicted SEED Role
"rRNA small subunit methyltransferase I" in subsystem Heat shock dnaK gene cluster extended
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.1.1.198
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (276 amino acids)
>LRK53_RS16300 16S rRNA (cytidine(1402)-2'-O)-methyltransferase (Rhodanobacter sp000427505 FW510-R12) MNRLSELGSLWVVATPIGHRDDLSARAIDTLRQVAVIAAEDTRHSRPLLVHHNIDTPLIA LHEHNEREAVESIVRRMQAGEAVALISDAGTPLISDPGFRLVRAARAAGIRCIPVPGACA AIAALSVAGLPSDRFVFEGFLPPKAASRRSRLQELAGDARTLIFYESSHRVAESLADMRD VFGAGREAVLARELTKLFETVIGKPLAELAARVANDPDQQRGECVILVAGRGEEADAKLA EGQRVFAILREELPPAKAAKLAAAISGAPRKTLYES