Protein Info for LRK53_RS16300 in Rhodanobacter sp000427505 FW510-R12

Annotation: 16S rRNA (cytidine(1402)-2'-O)-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF00590: TP_methylase" amino acids 10 to 210 (201 residues), 116.6 bits, see alignment E=1.6e-37 TIGR00096: 16S rRNA (cytidine(1402)-2'-O)-methyltransferase" amino acids 10 to 275 (266 residues), 261.7 bits, see alignment E=3.9e-82 PF23016: RsmI_C" amino acids 237 to 275 (39 residues), 46 bits, see alignment 3.7e-16

Best Hits

Swiss-Prot: 64% identical to RSMI_PSEAE: Ribosomal RNA small subunit methyltransferase I (rsmI) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K07056, (no description) (inferred from 66% identity to xcc:XCC0712)

MetaCyc: 51% identical to 16S rRNA 2'-O-ribose C1402 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11637 [EC: 2.1.1.198]

Predicted SEED Role

"rRNA small subunit methyltransferase I" in subsystem Heat shock dnaK gene cluster extended

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.198

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (276 amino acids)

>LRK53_RS16300 16S rRNA (cytidine(1402)-2'-O)-methyltransferase (Rhodanobacter sp000427505 FW510-R12)
MNRLSELGSLWVVATPIGHRDDLSARAIDTLRQVAVIAAEDTRHSRPLLVHHNIDTPLIA
LHEHNEREAVESIVRRMQAGEAVALISDAGTPLISDPGFRLVRAARAAGIRCIPVPGACA
AIAALSVAGLPSDRFVFEGFLPPKAASRRSRLQELAGDARTLIFYESSHRVAESLADMRD
VFGAGREAVLARELTKLFETVIGKPLAELAARVANDPDQQRGECVILVAGRGEEADAKLA
EGQRVFAILREELPPAKAAKLAAAISGAPRKTLYES