Protein Info for LRK53_RS16250 in Rhodanobacter sp000427505 FW510-R12

Annotation: undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 transmembrane" amino acids 64 to 82 (19 residues), see Phobius details amino acids 89 to 107 (19 residues), see Phobius details amino acids 175 to 191 (17 residues), see Phobius details PF03033: Glyco_transf_28" amino acids 1 to 135 (135 residues), 119.5 bits, see alignment E=1.2e-38 TIGR01133: undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase" amino acids 1 to 342 (342 residues), 329.8 bits, see alignment E=9.7e-103 PF04101: Glyco_tran_28_C" amino acids 175 to 337 (163 residues), 127.8 bits, see alignment E=4.5e-41

Best Hits

Swiss-Prot: 60% identical to MURG_ALKEH: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (murG) from Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)

KEGG orthology group: K02563, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC: 2.4.1.227] (inferred from 60% identity to aeh:Mlg_2193)

MetaCyc: 49% identical to N-acetylglucosaminyl transferase (Escherichia coli K-12 substr. MG1655)
acetylglucosaminyltransferase. [EC: 2.4.1.227]

Predicted SEED Role

"UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (EC 2.4.1.227)" in subsystem Peptidoglycan Biosynthesis (EC 2.4.1.227)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.227

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (348 amino acids)

>LRK53_RS16250 undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase (Rhodanobacter sp000427505 FW510-R12)
MAGGTGGHIFPGLAVAECLHAQGVPVVWLGAVGGMETKVVPAQQIELHTVAVGGLRGKGI
KTRLLAPLMLLRALFASLAVLRQVQPRSVLSMGGYVAGPGGLAAWLLRRPLLVHEQNRVA
GFTNRKLAGLAKRVLAGFAGALPRAEWVGNPVREAIAALPPPAARMAGRDGKPRLLVLGG
SLGARALNLALPRALTQLPPAQRPEVLHQCGSRGLDEAREAYAQAGVEAQVVAFIDDMAG
SYGWADLAVCRAGALTLAELAAAGLGAVLVPFPHAVDDHQTCNAEVLMAAGAAELMQENE
LDVQILAQRLASLLGDRHRLLAMAEAARTLAKPDAAQVIARACLEVAA