Protein Info for LRK53_RS16205 in Rhodanobacter sp000427505 FW510-R12

Annotation: preprotein translocase subunit SecA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 914 PF07517: SecA_DEAD" amino acids 7 to 397 (391 residues), 440.1 bits, see alignment E=1.1e-135 TIGR00963: preprotein translocase, SecA subunit" amino acids 28 to 814 (787 residues), 1116.7 bits, see alignment E=0 PF00270: DEAD" amino acids 99 to 216 (118 residues), 27 bits, see alignment E=1e-09 PF01043: SecA_PP_bind" amino acids 233 to 353 (121 residues), 131.8 bits, see alignment E=5e-42 PF21090: P-loop_SecA" amino acids 412 to 611 (200 residues), 302.2 bits, see alignment E=5.5e-94 PF07516: SecA_SW" amino acids 614 to 825 (212 residues), 223.2 bits, see alignment E=1e-69 PF02810: SEC-C" amino acids 894 to 911 (18 residues), 41.2 bits, see alignment (E = 3.4e-14)

Best Hits

Swiss-Prot: 73% identical to SECA_XANCB: Protein translocase subunit SecA (secA) from Xanthomonas campestris pv. campestris (strain B100)

KEGG orthology group: K03070, preprotein translocase subunit SecA (inferred from 71% identity to psu:Psesu_0649)

Predicted SEED Role

"Protein export cytoplasm protein SecA ATPase RNA helicase (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (914 amino acids)

>LRK53_RS16205 preprotein translocase subunit SecA (Rhodanobacter sp000427505 FW510-R12)
MFNRALTSLFGSRNERVLRQLSKSVNRINALEPEFEKLSDDELRGKTDVFKQRVAAGESL
DKLLPEAFAVVREAAKRTLGMRPYDVQMIGGMVLHQGKIAEMRTGEGKTLVGTLPVYLNA
LAGKGVHVVTVNDYLARRDSAQMGKLYNFLGLAVGVVYPGMDHADKHAAYAADITYGTNN
EFGFDYLRDNMALSKEQRYQRGLHYAIVDEVDSILIDEARTPLIISGPAEDSPQLYIAVN
KIVPQMVRQIEENGEGDYWVDEKQKQVHLSEAGMQHADELLRASGVIEQDSGLYDSKNLA
VVHHLNAALRANGIYQRDVDYIVRDGEVIIVDEFTGRTLPGRRWSDGLHQAVEAKEGVPI
QRENQTLATVTFQNLFRMYKKLAGMTGTADTEAFEFQSIYGLEVVVIPTHKPMIRKDNPD
MIFLSQTPKYNSVIEDIRACHQRGQPVLVGTTSIEVSELLSGLLKKAGVAHEVLNAKQHE
REAHIVAQAGAPGQVTIATNMAGRGTDIVLGGSLEAALAELPAEAGEADRQRVRAEWKKL
HERVVAAGGLHIIGTERHESRRIDNQLRGRSGRQGDPGSSRFYLSLEDNLLRIFGGEGLV
RWMKRFGMKDDDALEDRMISRQIEKAQRKVEQHNFDIRKHLLEFDDVANDQRKVIYRQRD
ELLDDDEVQATVADIRDDVVQSMVRAYVPDDSIDEQWDLAGLDRELESELGLSLDLKQWI
EQQHEIDAKMLLEHVRGAVHELFQAKEAQIGAETMRQLEKHIMLTVVDNAWKDHLASMDY
LRQGIYLVGYAQQDPKQAFKRESFKLFSDMLERIKAEVVQMLARIRIRSEEEVAAMEAEQ
RRLADRLQKQMLASGGGAPTEGAFGGAVAAEAAVGASMRLAQQPAQHDGSKVGRNDPCPC
GSGKKYKHCHGQLA