Protein Info for LRK53_RS16095 in Rhodanobacter sp000427505 FW510-R12

Annotation: peptide chain release factor N(5)-glutamine methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR00536: methyltransferase, HemK family" amino acids 16 to 272 (257 residues), 253.1 bits, see alignment E=2.9e-79 PF17827: PrmC_N" amino acids 17 to 70 (54 residues), 59.4 bits, see alignment E=2.2e-19 TIGR03534: protein-(glutamine-N5) methyltransferase, release factor-specific" amino acids 20 to 269 (250 residues), 300.9 bits, see alignment E=7.5e-94 PF05175: MTS" amino acids 98 to 188 (91 residues), 66.4 bits, see alignment E=1.2e-21 PF03602: Cons_hypoth95" amino acids 106 to 187 (82 residues), 25.4 bits, see alignment E=5.1e-09 PF10294: Methyltransf_16" amino acids 106 to 179 (74 residues), 21.7 bits, see alignment E=7.6e-08 PF06325: PrmA" amino acids 107 to 181 (75 residues), 29 bits, see alignment E=3.8e-10 PF13847: Methyltransf_31" amino acids 108 to 184 (77 residues), 55.7 bits, see alignment E=2.6e-18 PF13649: Methyltransf_25" amino acids 111 to 181 (71 residues), 49.4 bits, see alignment E=3.1e-16 PF08241: Methyltransf_11" amino acids 113 to 181 (69 residues), 37.1 bits, see alignment E=2.1e-12 PF08242: Methyltransf_12" amino acids 113 to 181 (69 residues), 34 bits, see alignment E=2.1e-11 PF01170: UPF0020" amino acids 120 to 191 (72 residues), 28.1 bits, see alignment E=8.1e-10

Best Hits

Swiss-Prot: 62% identical to PRMC_XANCP: Release factor glutamine methyltransferase (prmC) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K02493, methyltransferase [EC: 2.1.1.-] (inferred from 65% identity to smt:Smal_0690)

Predicted SEED Role

"Protein-N(5)-glutamine methyltransferase PrmC, methylates polypeptide chain release factors RF1 and RF2"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (275 amino acids)

>LRK53_RS16095 peptide chain release factor N(5)-glutamine methyltransferase (Rhodanobacter sp000427505 FW510-R12)
MPDVRAMLAAAVVRLGERADAEALLLHVLQQPRSWLFAHADEVPDMDVQTAYAALVERRA
AGEPVAYITGRRGFWSLELEVNPATLIPRPETELLVELALQRLPSVAACNVADLGTGSGA
VALAIARERPRARVVATDASAAALAVAQRNAQRLGLGNVAFVHGDWLAPLAGQHFDLIVS
NPPYIEAADPHLAQGDLRFEPPAALASGPDGLDAIRRIVRDARAHLHPDAWLLFEHGWNQ
GLAARVLLAEAGYADVFSALDLEQRDRVSGGRRSA