Protein Info for LRK53_RS16040 in Rhodanobacter sp000427505 FW510-R12

Annotation: acyl-CoA dehydrogenase C-terminal domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 596 PF02771: Acyl-CoA_dh_N" amino acids 78 to 159 (82 residues), 30.8 bits, see alignment E=9.8e-11 PF02770: Acyl-CoA_dh_M" amino acids 165 to 278 (114 residues), 50 bits, see alignment E=8.2e-17 PF00441: Acyl-CoA_dh_1" amino acids 290 to 457 (168 residues), 71.4 bits, see alignment E=2.9e-23 PF22924: ACOX_C_alpha1" amino acids 299 to 451 (153 residues), 29.5 bits, see alignment E=1.8e-10 PF08028: Acyl-CoA_dh_2" amino acids 307 to 450 (144 residues), 31.9 bits, see alignment E=4.5e-11 PF12806: Acyl-CoA_dh_C" amino acids 474 to 592 (119 residues), 98 bits, see alignment E=1.3e-31

Best Hits

KEGG orthology group: None (inferred from 61% identity to sml:Smlt3352)

Predicted SEED Role

"Acyl-CoA dehydrogenase (EC 1.3.8.7)" (EC 1.3.8.7)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.8.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (596 amino acids)

>LRK53_RS16040 acyl-CoA dehydrogenase C-terminal domain-containing protein (Rhodanobacter sp000427505 FW510-R12)
MTAYKAPLDDLRFALFDVLDAEQTLTSLQGGEAHSRDLLDAVLDEAGRLSEQLLAPTNAP
ADAEGCHYDKATQTVTTPKGFKEAFKAFTEGGWTGLTNPEAYGGQALPGVLGIATTEIFQ
SGNLAWSLYPLLSEGATHAMEQHGEAWQRERFMKPIVAGRWTGTMCLTEPQAGSDLGLLK
TRAEPAAADADGHAVYKISGTKIFISAGEHDLAENIVHLVLARLPDAPEGSRGISMFIVP
KFKVNQDGSLGARNTVAAGAIEHKMGIHACSTCVMNFDGAEGYLIGKPHKGLAAMFTMMN
AARLSVGVQGLALAERALQNSLNYARERLQSRSLSGPKFPDKPADNLLVQPDVRRMLLTQ
RAFVEGSRALLLYTALQTDIEHRAADEAARQKAGELVAFLIPIAKGMTTELAQECTKEAL
QIYGGHGYIAENGMEQFVRDARIITLYEGTTGIQAADLLGRKILQLQGVGAKHFLQEISA
FCQQHSADQSLRGLIGPLAIATKEWSELTVSLAQRVAANPEELGAAATDYLYYSGYVTLA
YLWARSVATAEAGAQSAAFKQAKRDTAAFYFARILPRTLTHKAAIEAGVTTLPEIA