Protein Info for LRK53_RS16000 in Rhodanobacter sp000427505 FW510-R12

Annotation: MoxR family ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 PF20030: bpMoxR" amino acids 27 to 190 (164 residues), 34.8 bits, see alignment E=3.1e-12 PF00158: Sigma54_activat" amino acids 41 to 165 (125 residues), 20.8 bits, see alignment E=9.5e-08 PF07726: AAA_3" amino acids 55 to 185 (131 residues), 216.9 bits, see alignment E=2.5e-68 PF07728: AAA_5" amino acids 55 to 183 (129 residues), 48.9 bits, see alignment E=2.4e-16 PF00004: AAA" amino acids 56 to 189 (134 residues), 26.7 bits, see alignment E=2.4e-09 PF17863: AAA_lid_2" amino acids 255 to 323 (69 residues), 71.3 bits, see alignment E=1.6e-23

Best Hits

KEGG orthology group: K03924, MoxR-like ATPase [EC: 3.6.3.-] (inferred from 68% identity to smt:Smal_3847)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (334 amino acids)

>LRK53_RS16000 MoxR family ATPase (Rhodanobacter sp000427505 FW510-R12)
MSTETLVAPATPPAPLPIAELGEHARALRTQVARAFIGQTEVFEQVLLALLASGHVLIEG
VPGLGKTLLVRALAASVGCSFGRVQFTPDLMPADVTGHAIYDPKTEAFKIRSGPVFTNLL
LADEINRAPAKTQAALLESMQEGQVTIEGRRFALPAPFMVVATQNPIEQEGTYPLPEAQL
DRFLIKVTIGYPTLEDECRMVAGVVNGKVAAELDVSQVKPVLSQAQLLTAQRGVAAIRMD
AAVTDYAVRIVRSTREWPGVIGGAGPRGGLALARLARAQAAIDGRDFVTPDDVRAVALPA
LRHRLLLAPEALLERQRPDDVLKALLHKVPAPRQ