Protein Info for LRK53_RS15825 in Rhodanobacter sp000427505 FW510-R12

Annotation: CDF family Co(II)/Ni(II) efflux transporter DmeF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 transmembrane" amino acids 29 to 47 (19 residues), see Phobius details amino acids 59 to 76 (18 residues), see Phobius details amino acids 92 to 114 (23 residues), see Phobius details amino acids 130 to 148 (19 residues), see Phobius details amino acids 189 to 209 (21 residues), see Phobius details amino acids 215 to 235 (21 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 23 to 318 (296 residues), 196.5 bits, see alignment E=2.9e-62 PF01545: Cation_efflux" amino acids 30 to 246 (217 residues), 123.5 bits, see alignment E=5.1e-40

Best Hits

KEGG orthology group: None (inferred from 68% identity to ppf:Pput_4528)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (321 amino acids)

>LRK53_RS15825 CDF family Co(II)/Ni(II) efflux transporter DmeF (Rhodanobacter sp000427505 FW510-R12)
MPAPDVSAFIHSHQFNHVDAKAERNTRRVVFITAAMMVVEIAGGYWLNSMALLADGWHMS
SHALAMGLSVMAYVFARRYAQDGRFAFGTWKIEILGGYSSALLLAVVAALMMVQSLERLF
VPAAIRYDDAILIAVLGLGVNLLCAWLLKGEHHHGHAHGHDHGHDHGHDHAHGHHGHDGR
HHDMNLRAAYLHVVADAATSVLAIVALVGGKLYGAAWLDPAMGIVGSVLVARWAWGLLRE
SGRILLDAEMDQPVVEEIRDVVREKFATAAISDLHVWRVGRDSYACILGLVASTAISAED
VRRQLAIHEELVHVTVEVAAA