Protein Info for LRK53_RS15710 in Rhodanobacter sp000427505 FW510-R12

Annotation: ribosome-associated translation inhibitor RaiA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 107 TIGR00741: ribosomal subunit interface protein" amino acids 1 to 97 (97 residues), 86.7 bits, see alignment E=6.2e-29 PF02482: Ribosomal_S30AE" amino acids 4 to 92 (89 residues), 73.8 bits, see alignment E=7.7e-25

Best Hits

Swiss-Prot: 44% identical to HPF_AZOVI: Ribosome hibernation promoting factor (hpf) from Azotobacter vinelandii

KEGG orthology group: K05808, putative sigma-54 modulation protein (inferred from 50% identity to dar:Daro_4148)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (107 amino acids)

>LRK53_RS15710 ribosome-associated translation inhibitor RaiA (Rhodanobacter sp000427505 FW510-R12)
MQFQLSGQQIEVTPALRDHATAKLDRLTRLDDKLKSLAIVLSVDKLQHRADGTLGVVGAT
LHAEATEADMYASIDVLFDKLVAQLRKYREKVADKHQRETRDERQYG