Protein Info for LRK53_RS15655 in Rhodanobacter sp000427505 FW510-R12

Annotation: phosphoribosylformylglycinamidine cyclo-ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00878: phosphoribosylformylglycinamidine cyclo-ligase
  • amino acids 5 to 331 (327 residues), 442.2 bits, E=5.9e-137
• PF00586: AIRS
  • amino acids 57 to 162 (106 residues), 78.7 bits, E=4.5e-26
• PF02769: AIRS_C
  • amino acids 175 to 334 (160 residues), 122.4 bits, E=2e-39

Best Hits

Swiss-Prot: 76% identical to PUR5_XANCP: Phosphoribosylformylglycinamidine cyclo-ligase (purM) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K01933, phosphoribosylformylglycinamidine cyclo-ligase [EC: 6.3.3.1] (inferred from 76% identity to psu:Psesu_1078)

MetaCyc: 60% identical to phosphoribosylformylglycinamide cyclo-ligase (Escherichia coli K-12 substr. MG1655)
Phosphoribosylformylglycinamidine cyclo-ligase. [EC: 6.3.3.1]

Predicted SEED Role

"Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1)" in subsystem De Novo Purine Biosynthesis (EC 6.3.3.1)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
• superpathway of 5-aminoimidazole ribonucleotide biosynthesis (6/6 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis II (5/5 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.3.1

Protein Sequence (342 amino acids)

>LRK53_RS15655 phosphoribosylformylglycinamidine cyclo-ligase (Rhodanobacter sp000427505 FW510-R12)
MSDALTYRAAGVDIDAGNALVERIKPLVKRTFRPEVMGGLGGFGGLFDLSGRYKEPVLVS
GTDGVGTKLKLAQTLHRHDTIGIDLVGMCVNDVLVQGAEPLFFLDYFATGKLDVDTAAAV
VGGIATGCELASCALIGGETAEMPDMYPPGEYDLAGFTVGAVEKSRMLTGAAIVAGDVVL
GVASSGPHSNGYSLIRRILERAGNPFDLDLGGVKLVDALMAPTTIYVKPMLELLREIPVH
GMAHITGGGLKENIIRVVPDGLGIALDASAIVLPPVFDWLMREGKVAREEMWRTFNCGIG
FTVILPRDAVAGASALLTKHSLASSVIGAIVPAAGDERVQIG