Protein Info for LRK53_RS15630 in Rhodanobacter sp000427505 FW510-R12

Annotation: RNA methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 TIGR00050: RNA methyltransferase, TrmH family, group 1" amino acids 8 to 242 (235 residues), 202.5 bits, see alignment E=4.6e-64 PF00588: SpoU_methylase" amino acids 12 to 161 (150 residues), 88.2 bits, see alignment E=2.9e-29

Best Hits

Swiss-Prot: 50% identical to TRMJ_CITK8: tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ (trmJ) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: K02533, tRNA/rRNA methyltransferase [EC: 2.1.1.-] (inferred from 55% identity to sml:Smlt3320)

MetaCyc: 50% identical to tRNA Cm32/Um32 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11866 [EC: 2.1.1.200, 2.1.1.205]; 2.1.1.200 [EC: 2.1.1.200, 2.1.1.205]

Predicted SEED Role

"tRNA:Cm32/Um32 methyltransferase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.200 or 2.1.1.205

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (251 amino acids)

>LRK53_RS15630 RNA methyltransferase (Rhodanobacter sp000427505 FW510-R12)
MTDLHHLAARIRYVLVRTSHPGNIGSAARAIRTMGFARMELVAPHRFPDPEANALAAGAD
DVLVHAGIHGELVDGLAGSSLALGLSARRRGVNLPELSPREAARQALAAATRGEQVALVF
GNERTGLENEELARCHAMVRIPSVDDFSSLNLAQAVQVMAYELRMAMLGDEPPPPPEHDE
PPADAAQMEQFYRHLAQTLDDIDFHKGREPTTIMLRLRKLFQRAQPDARELRVLHGILAD
AQRMAGLANGK