Protein Info for LRK53_RS15405 in Rhodanobacter sp000427505 FW510-R12

Annotation: FemAB family PEP-CTERM system-associated protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 TIGR03019: FemAB-related protein, PEP-CTERM system-associated" amino acids 26 to 353 (328 residues), 481.7 bits, see alignment E=5.2e-149 PF13480: Acetyltransf_6" amino acids 162 to 295 (134 residues), 65.5 bits, see alignment E=9e-22 PF04339: FemAB_like" amino acids 174 to 311 (138 residues), 29.7 bits, see alignment E=5.7e-11 PF02388: FemAB" amino acids 227 to 298 (72 residues), 26.4 bits, see alignment E=4.9e-10

Best Hits

KEGG orthology group: None (inferred from 59% identity to noc:Noc_1980)

Predicted SEED Role

"FIG070318: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (353 amino acids)

>LRK53_RS15405 FemAB family PEP-CTERM system-associated protein (Rhodanobacter sp000427505 FW510-R12)
MLDHAHASHSADPCTVRRLERGDERRWDNFVEDAPRATFFHRVAWRGILEQVLGHRCHYL
YAERHGVITGVLPLAEIRSRLFGHALISMPFCVYGGVVAGDPGSEARLTRAATALADELR
VDYLELRDRELRHPGWPVKDLYVGFRKAICADHDENLKAIPRKQRAMVRKGMGAGLQVRH
DGSIAEFYRVYAESVRNLGTPVLSRHYYTRLQQAFGEDCEVSVVTHQGQPVAAVMSFYFR
DEVHPYYGGSVARGRDLAANDFMYWAVMQRAAERGARLFDYGRSKQDSGSYHFKKHWGFE
PQPLPYAYYLVRARTVPNISPTNSRYRLFIEAWKRLPLPVSCALGPWLARDLG