Protein Info for LRK53_RS15390 in Rhodanobacter sp000427505 FW510-R12

Annotation: TIGR03088 family PEP-CTERM/XrtA system glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 TIGR03088: sugar transferase, PEP-CTERM/EpsH1 system associated" amino acids 5 to 377 (373 residues), 433.8 bits, see alignment E=2.8e-134 PF13439: Glyco_transf_4" amino acids 17 to 173 (157 residues), 74.8 bits, see alignment E=2.6e-24 PF13579: Glyco_trans_4_4" amino acids 18 to 170 (153 residues), 59.4 bits, see alignment E=1.7e-19 PF20706: GT4-conflict" amino acids 194 to 347 (154 residues), 29.5 bits, see alignment E=1.2e-10 PF00534: Glycos_transf_1" amino acids 198 to 354 (157 residues), 128 bits, see alignment E=8.6e-41 PF13692: Glyco_trans_1_4" amino acids 199 to 341 (143 residues), 119.7 bits, see alignment E=3.6e-38 PF13524: Glyco_trans_1_2" amino acids 267 to 366 (100 residues), 31.1 bits, see alignment E=6.3e-11

Best Hits

KEGG orthology group: None (inferred from 43% identity to nhl:Nhal_3237)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (398 amino acids)

>LRK53_RS15390 TIGR03088 family PEP-CTERM/XrtA system glycosyltransferase (Rhodanobacter sp000427505 FW510-R12)
MNAQPLIVHVLYRLDTGGMEHMLVTLINQTCQCYRHAVICLEGYGALRDQIEPDDVVCVA
LAKRPGKDWRCYFRLWRVLRDLRPDLVHTYNIGAVDVAPVARLAGVRRVVHAERGRDAAD
PRGESRKHQLLRRWLLPFIDRYLAVSMDLQDWLVEKVGIPFSRVACIPNGIDATAFAGTA
HERGVRPLLGAFAPAGTVLIGTVGRLDAVKDHAGLIAAFRILCEALPHQREQLRLVLLGG
GPQRAALEAQIARGELSTQVRLLGNRSDVAALLAEFDVFALSSIAEGMPGVLLEAMASGL
PVVATDVGGVGEVVVAGMTGTLVPAGDPHALAAALRTYVADEQLRRRHGAAGRARVAARF
SLHSMVSAYVALYDELLGRQANAVQPHMVSGLTGHKEH